MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fu-2002-2 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 fu-2002-5 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 fu-2002-1 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 fu-2002-3 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 fu-2002-4 Detection of protein-protein interactions among lens crystallins in a mammalian two-hybrid system assay. in vivo in vivo beta lactamase beta lactamase complementation beta lactamase predetermined predetermined participant predetermined Fu L., Liang JJ. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 2002 crgc_human Gamma-crystallin C CRYGC CRYG3 Gamma-C-crystallin Gamma-crystallin 2-1 Gamma-crystallin 3 protein protein human Homo sapiens Human MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY crbb2_human Beta-crystallin B2 Beta-B2 crystallin Beta-crystallin Bp CRYBB2 CRYB2 CRYB2A protein protein human Homo sapiens Human MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN cryaa_human Alpha-crystallin A chain CRYAA CRYA1 HSPB4 Heat shock protein beta-4 protein protein human Homo sapiens Human MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS cryab_human Alpha-crystallin B chain CRYAB CRYA2 Renal carcinoma antigen NY-REN-27 Alpha(B)-crystallin Rosenthal fiber component Heat shock protein beta-5 HSPB5 protein protein human Homo sapiens Human MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK AE08BED46B7849CB hspb1_human Heat shock protein beta-1 HSPB1 HSP27 HSP28 Heat shock 27 kDa protein Stress-responsive protein 27 Estrogen-regulated 24 kDa protein 28 kDa heat shock protein protein protein human Homo sapiens Human MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 1B4DC44A6F6606D5 crygc-crybb2-1 10468 crgc_human 10473 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 crbb2_human 10474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint cryaa-crybb2-1 10468 crbb2_human 10474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 cryaa_human 10475 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint crygc-cryab-4 10468 cryab_human 10476 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 crgc_human 10473 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint cryaa-cryab-4 10468 cryab_human 10476 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 cryaa_human 10475 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint crybb2-cryab-2 10468 cryab_human 10476 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 crbb2_human 10474 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint cryaa-crygc-4 10468 cryaa_human 10475 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 crgc_human 10473 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint cryaa-crygc-5 10469 crgc_human 10473 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 cryaa_human 10475 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint crybb2-crygc-1 10469 crbb2_human 10474 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 crgc_human 10473 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint cryaa-crybb2-2 10469 cryaa_human 10475 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 crbb2_human 10474 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint cryab-crygc-1 10469 crgc_human 10473 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 cryab_human 10476 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint cryab-crybb2 10469 crbb2_human 10474 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 cryab_human 10476 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint cryaa-cryab-6 10469 cryaa_human 10475 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 cryab_human 10476 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 association association false false false Technique: CAT assay homomint mint cryaa-crybb2 10470 cryaa_human 10475 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 crbb2_human 10474 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint crygc-crybb2 10470 crbb2_human 10474 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 crgc_human 10473 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint crygc-cryab-3 10470 crgc_human 10473 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cryab_human 10476 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint crybb2-cryab-1 10470 cryab_human 10476 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 crbb2_human 10474 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint cryaa-crygc-3 10470 crgc_human 10473 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cryaa_human 10475 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint hspb1-crybb2 10471 crbb2_human 10474 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 hspb1_human 10477 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint hspb1-cryab 10471 cryab_human 10476 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 hspb1_human 10477 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint hspb1-cryaa 10471 hspb1_human 10477 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 cryaa_human 10475 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint cryaa-cryab-5 10472 cryaa_human 10475 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 cryab_human 10476 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false Technique: CAT assay homomint mint