MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jacotot-2001-1 Control of mitochondrial membrane permeabilization by adenine nucleotide translocator interacting with HIV-1 viral protein rR and Bcl-2. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Jacotot E., Ferri KF., El Hamel C., Brenner C., Druillennec S., Hoebeke J., Rustin P., Métivier D., Lenoir C., Geuskens M., Vieira HL., Loeffler M., Belzacq AS., Briand JP., Zamzami N., Edelman L., Xie ZH., Reed JC., Roques BP., Kroemer G. Virus - Publications including interactions involving viral proteins J. Exp. Med. (0022-1007) 2001 vpr_hv1a2 Protein Vpr vpr Viral protein R R ORF protein protein protein hv1a2 Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHSLGQYIYETYGDTWAGVEAIIRILQQLLFIHFRIGCQHSRIGIIQQRRARRNGASRS mint Involved in the transport of the viral pre-integration (PIC) complex to the nucleus during the early stages of the infection. This function is crucial for viral infection of non-dividing macrophages. May interact with karyopherin alpha/KPNA1 and KPNA2 to increase their affinity for proteins containing basic-type nuclear localization signal, including the viral matrix protein MA, thus facilitating the translocation of the viral genome into the nucleus. May also act directly at the nuclear pore complex, by binding nucleoporins phenylalanine-glycine (FG)-repeat regions. Has an anti-apoptotic effect, whereas high level of expression induces apoptosis. Interacts with mitochondrial permeability transition pore complex (PTPC), presumably through the binding of ANT proteins. This induces a rapid dissipation of the mitochondrial transmembrane potential, and mitochondrial release of apoptogenic proteins such as cytochrome C or apoptosis inducing factors. Prevents infected cells from undergoing mitosis and proliferating, by inducing arrest or delay in the G2 phase of the cell cycle. The arrest in G2 is characterized by low levels of CCNB1-CDC2 complex and corresponding inhibitory phosphorylation of CDC2. Cell cycle arrest creates a favourable environment for maximizing viral expression and production. This may be mediated by interacting with and inhibiting human CDC25C, which normally activates the CCNB1-CDC2 complex, or by binding SF3B2/SAP145. This function is independent of nuclear localization. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the Vpr carried into the virion. Stimulates gene expression driven by the HIV-1 LTR by interacting with human SP1, TFIIB and TFIID. Moreover, the G2/M cell cycle arrest creates a cellular environment where the HIV-1 LTR is transcriptionally more active. Essential for unintegrated viral DNA expression. Detected in the serum and cerebrospinal fluid of AIDS patient, where it may induce cell death to bystander cells. This necrotic or apoptotic effect might function by entering target cell plasma membrane to form ion channel adt1_rat ADP/ATP translocase 1 Adenine nucleotide translocator 1 ADP,ATP carrier protein 1 Solute carrier family 25 member 4 Slc25a4 Ant1 Aac1 protein protein rat Rattus norvegicus (Rat) Rat MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTKIFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGRKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV vpr-slc25a4-1 1358 vpr_hv1a2 1359 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 adt1_rat 1360 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint