MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint butteron-2000-1 Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. unknown Unknown filamentous phage filamentous phage display filamentous phage predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation butteron-2000-2 Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation butteron-2000-3 Phage display screening reveals an association between germline-specific transcription factor Oct-4 and multiple cellular proteins. unknown Unknown anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Butteroni C., De Felici M., Schöler HR., Pesce M. Virus - Publications including interactions involving viral proteins J. Mol. Biol. (0022-2836) 2000 rapid curation rapid curation e1a_ade12 Early E1A protein Early E1A 29.5 kDa protein protein protein ade12 Human adenovirus A serotype 12 (HAdV-12) Human adenovirus 12 MRTEMTPLVLSYQEADDILEHLVDNFFNEVPSDDDLYVPSLYELYDLDVESAGEDNNEQAVNEFFPESLILAASEGLFLPEPPVLSPVCEPIGGECMPQLHPEDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCKSCEHHRNSTGNTDLMCSLCYLRAYNMFIYSPVSDNEPEPNSTLDGDERPSPPKLGSAVPEGVIKPVPQRVTGRRRCAVESILDLIQEEEREQTVPVDLSVKRPRCN E1A protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1 by direct competition for the same binding site on RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. The tumorigenesis-restraining activity of E1A may be related to the disruption of the host CtBP-CtIP complex through the CtBP binding motif mint po5f1_human POU domain, class 5, transcription factor 1 Octamer-binding transcription factor 3 Octamer-binding protein 3 POU5F1 OCT3 OCT4 OTF3 Octamer-binding protein 4 protein protein human Homo sapiens Human MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN q8jsk4_ade03 Early E1A protein E1A protein protein hadv-3 Human adenovirus B serotype 3 HAdV-3 Human adenovirus 3 MRHLRFLPQEVISSETGIEILEFVVNTLMGDDPEPPVQPFDPPTLHDLYDLEIDGPEDPNEEAVNGFFTDSMLLAADEGLDINPPPETLVTPGVVVESGIGGKKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPGHGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPAPANVCKPIPVKPKPGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ mint hmgb1_mouse High mobility group protein B1 Hmgb1 Hmg-1 Hmg1 High mobility group protein 1 protein protein mouse Mus musculus Mouse MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE hmgb2_mouse High mobility group protein B2 Hmgb2 Hmg2 High mobility group protein 2 protein protein mouse Mus musculus Mouse MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDLAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSENRPKIKIEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEEEDDEEEEEDEE e1a-pou5f1-2 744934 e1a_ade12 744937 unspecified role unspecified role bait bait po5f1_human 744938 unspecified role unspecified role prey prey physical association physical association false false false F1 F3 homomint mint e1a-pou5f1-3 744934 q8jsk4_ade03 744939 unspecified role unspecified role bait bait po5f1_human 744938 unspecified role unspecified role prey prey physical association physical association false false false F1 F3 homomint mint pou5f1-hmgb1 744934 po5f1_human 744938 unspecified role unspecified role bait bait hmgb1_mouse 744940 unspecified role unspecified role prey prey physical association physical association false false false F4A,C homomint mint e1a-pou5f1-4 744935 e1a_ade12 744937 unspecified role unspecified role neutral component neutral component po5f1_human 744938 unspecified role unspecified role neutral component neutral component physical association physical association false false false F2 homomint mint e1a-pou5f1-5 744935 q8jsk4_ade03 744939 unspecified role unspecified role neutral component neutral component po5f1_human 744938 unspecified role unspecified role neutral component neutral component physical association physical association false false false F2 homomint mint hmgb1-pou5f1 744935 hmgb1_mouse 744940 unspecified role unspecified role neutral component neutral component po5f1_human 744938 unspecified role unspecified role neutral component neutral component physical association physical association false false false F4B homomint mint pou5f1-hmgb1-1 744936 po5f1_human 744938 unspecified role unspecified role bait bait hmgb1_mouse 744940 unspecified role unspecified role prey prey physical association physical association false false false F5 homomint mint pou5f1-hmgb2 744936 hmgb2_mouse 744941 unspecified role unspecified role prey prey po5f1_human 744938 unspecified role unspecified role bait bait physical association physical association false false false F5 mint