MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wei-2000a-1 tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins Genes Dev. (0890-9369) 2000 wei-2000a-2 tBID, a membrane-targeted death ligand, oligomerizes BAK to release cytochrome c. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wei MC., Lindsten T., Mootha VK., Weiler S., Gross A., Ashiya M., Thompson CB., Korsmeyer SJ. Virus - Publications including interactions involving viral proteins Genes Dev. (0890-9369) 2000 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bid-bak1-2 10011 bid_mouse 10013 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P15 Stoichiometry: 1.0 bak_human 10014 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false homomint mint bid-bak1-3 10012 bid_mouse 10013 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P15 Stoichiometry: 1.0 bak_human 10014 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint