HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html sabile-1999-1 Hepatitis C virus core protein binds to apolipoprotein AII and its secretion is modulated by fibrates. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sabile A., Perlemuter G., Bono F., Kohara K., Demaugre F., Kohara M., Matsuura Y., Miyamura T., Bréchot C., Barba G. Virus - Publications including interactions involving viral proteins HCV isolate could not be traced so, the HCV isolate H was used instead. Interactions involving transfected ApoAII could not be curated as the species of origin of the construct could not be traced. brechot@necker.fr Hepatology (0270-9139) 1999 imex curation Only protein-protein interactions imex curation sabile-1999-2 Hepatitis C virus core protein binds to apolipoprotein AII and its secretion is modulated by fibrates. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sabile A., Perlemuter G., Bono F., Kohara K., Demaugre F., Kohara M., Matsuura Y., Miyamura T., Bréchot C., Barba G. Virus - Publications including interactions involving viral proteins HCV isolate could not be traced so, the HCV isolate H was used instead. Interactions involving transfected ApoAII could not be curated as the species of origin of the construct could not be traced. brechot@necker.fr Human liver cDNA Hepatology (0270-9139) 1999 imex curation Only protein-protein interactions imex curation p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 apoa2_human Apolipoprotein A-II APOA2 Apolipoprotein A2 protein protein human Homo sapiens Human MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ core-apoaii-2 1499203 n/a 1499205 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1499206 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1 core-apoaii-1 1499204 n/a 1499205 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1499206 unspecified role unspecified role prey prey physical association physical association false false false Results