IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ coskun-2012-1 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Coskun M., Olsen AK., Holm TL., Kvist PH., Nielsen OH., Riis LB., Olsen J., Troelsen JT. Ulcerative colitis - Interactions of proteins identified as having a link to ulcerative colitis mehmet.coskun@regionh.dk Biochimica et biophysica acta 2012 Only protein-protein interactions imex curation imex curation IBD - Inflammatory bowel disease cdx2_human_gene CDX2_HUMAN_GENE gene gene human Homo sapiens Human cdx2_human Homeobox protein CDX-2 CDX2 CDX3 CDX-3 Caudal-type homeobox protein 2 protein protein human Homo sapiens Human MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ mep1a_human_gene Meprin A subunit alpha MEP1A gene gene human Homo sapiens Human cdx2-cdx2_human_gene-2 1852827 N/A 1852828 unspecified role unspecified role prey prey 5-prime and 3-prime regulatory regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852829 unspecified role unspecified role bait bait association association false false false 5B TNF-alpha (P01375) P01375 decreases binding of Q99626 to ENSG00000165556 P01375 decreases expression at RNA level of ENSG00000165556 cdx2-mep1a-1 1852827 N/A 1852830 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852829 unspecified role unspecified role bait bait association association false false false 5Bi TNF-alpha (P01375) P01375 decreases binding of Q99626 to ENSG00000112818 Q99626 increases expression at RNA level of ENSG00000112818 P01375 decreases expression at RNA level of ENSG00000112818