IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brenman-1998-5 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-9 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-2 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a gamma GT11 brain rat cDNA library was used J. Neurosci. (0270-6474) 1998 brenman-1998-10 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-3 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-8 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-1 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-4 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-6 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. rat-brain Rattus norvegicus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 brenman-1998-7 Localization of postsynaptic density-93 to dendritic microtubules and interaction with microtubule-associated protein 1A. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Brenman JE., Topinka JR., Cooper EC., McGee AW., Rosen J., Milroy T., Ralston HJ., Bredt DS. Synapse - Interactions of proteins with an established role in the presynapse. The bait used for interaction detection of the far-western has a c-terminus PKA consensus phosphorylation tag. This tag was used to radiolabel the bait by phosphorylation with ATP gamma 32P. fig 3a J. Neurosci. (0270-6474) 1998 dlg4_rat Disks large homolog 4 Dlg4 Dlgh4 Postsynaptic density protein 95 Synapse-associated protein 90 Psd95 protein protein rat Rattus norvegicus (Rat) Rat MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL map1a_rat Microtubule-associated protein 1A Map1a Mtap1a protein protein rat Rattus norvegicus (Rat) Rat MDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRHLDFLRYPVATQKDLAAGAVPANLKPSKIKHRADSKESLKAAPKTAVSKLAKREEVLEEGAKEARSELAKELAKTEKKAKEPSEKPPEKPSKSERVRGESSEALKAEKRRLIKDKAGKKHLKEKISKLEEKKDKEKKEIKKERKELKKEEGRKEEKKDAKKDEKRKDTKPEVKKLSKPDLKPFTPEVRKTLYKAKAPGRVKVDKGRAARGEKELSSEPRTPPAQKGAAPPAAVSGHRELALSSPEDLTQDFEELKREERGLLAEQRDTGLGEKPLPADATEQGHPSAAIQVTQPSGPVLEGEHVEREKEVVPDSPGDKGSTNRGPDSGAEVEKEKETWEERKQREAELGPENTAAREESEAEVKEDVIEKAELEEMEETHPSDEEGEETKAESFYQKHTQEALKASPKSREALGGRDLGFQGKAPEKETASFLSSLATPAGATEHVSYIQDETIPGYSETEQTISDEEIHDEPDERPAPPRFPTSTYDLSGPEGPGPFEASQAADSAVPASSSKTYGAPETELTYPPNMVAAPLAEEEHVSSATSITECDKLSSFATSVAEDQSVASLTAPQTEETGKSSLLLDTVTSIPSSRTEATQGLDYVPSAGTISPTSSLEEDKGFKSPPCEDFSVTGESEKKGETVGRGLSGEKAVGKEEKYVVTSEKLSGQYAAVFGAPGHTLPPGEPALGEVEERCLSPDDSTVKMASPPPSGPPSAAHTPFHQSPVEDKSEPRDFQEDSWGETKHSPGVSKEDSEEQTVKPGPEEGTSEEGKGPPTRSPQAQDMPVSIAGGQTGCTIQLLPEQDKAIVFETGEAGSNLGAGTLPGEVRTSTEEATEPQKDEVLRFTDQSLSPEDAESLSVLSVVSPDTTKQEATPRSPCSLKEQQPHKDLWPMVSPEDTQSLSFSEESPSKETSLDISSKQLSPESLGTLQFGELNLGKEERGPVMKAEDDSCHLAPVSIPEPHRATVSPSTDETPAGTLPGGSFSHSALSVDRKHSPGEITGPGGHFMTSDSSLTKSPESLSSPAMEDLAVEWEGKAPGKEKEPELKSETRQQKGQILPEKVAVVEQDLIIHQKDGALDEENKPGRQQDKTPEQKGRDLDEKDTAAELDKGPEPKEKDLDREDQGQRAGPPAEKDKASEQRDTDLQQTQATEPRDRAQERRDSEEKDKSLELRDRTPEEKDRILVQEDRAPEHSIPEPTQTDRAPDRKGTDDKEQKEEASEEKEQVLEQKDWALGKEGETLDQEARTAEQKDETLKEDKTQGQKSSFVEDKTTTSKETVLDQKSAEKADSVEQQDGAALEKTRALGLEESPAEGSKAREQEKKYWKEQDVVQGWRETSPTRGEPVGGQKEPVPAWEGKSPEQEVRYWRDRDITLQQDAYWRELSCDRKVWFPHELDGQGARPRYCEERESTFLDEGPDEQEITPLQHTPRSPWTSDFKDFQEPLPQKGLEVERWLAESPVGLPPEEEDKLTRSPFEIISPPASPPEMTGQRVPSAPGQESPVPDTESTAPMRNEPTTPSWLAEIPPWVPKDRPLPPAPLSPAPAPPTPAPEPHTPVPFSWGLAEYDSVVAAVQEGAAELEGGPYSPLGKDYRKAEGEREGEGGAGAPDSSSFSPKVPEAGESLATRDTEQTEPEQREPTPYPDERSFQYADIYEQMMLTGLGPACPTREPPLGASGDWPPHLSTKEEAAGCNTSAEKETSSPASPQNLQSDTPAFSYASLAGPAVPPRQEPDPGPNVEPSITPPAVPPRAPISLSKDLSPPLNGSTVSCSPDRRTPSPKETGRGHWDDGTNDSDLEKGAREQPEKETRSPSPHHPMPMGHSSLWPETEAYSSLSSDSHLGSVRPSLDFPASAFGFSSLQPAPPQLPSPAEPRSAPCGSLAFSGDRALALVPGTPTRTRHDEYLEVTKAPSLDSSLPQLPSPSSPGGPLLSNLPRPASPALSEGSSSEATTPVISSVAERFPPGLEAAEQSAEGLGSGKESAAHSLWDLTPLSPAPSASLDLAPAPAPAPAPAPGLPGDLGDGTLPCRPECTGELTKKPSPFLSPSGDHEANGPGETSLNPPGFVTATAEKEEAEAPHAWERGSWPEGAERSSRPDTLLSSEQPLRPGKSSGGPPCSLSSEVEAGPQGCATDPRPHCGELSPSFLNPPLPPSTDDSDLSTEEARLAGKGGRRRVGRPGATGGPCPMADETPPTSASDSGSSQSDSDVPPETEECPSITAEAALDSDEDGDFLPVDKAGGVSGTHHPRPGHDPPPTPLPDPRPSPPRPDVCMADPEGLSSESGRVERLREKGRPGRRAPGRAKPASPARRLDIRGKRSPTPGKGPVDRTSRTVPRPRSTPSQVTSAEEKDGHSPMSKGLVNGLKAGSTALGSKGGSGPPVYVDLAYIPNHCSGKTADQDFFRRVRASYYVVSGNDPANGEPSRAVLDALLEGKAQWGENLQVTLIPTHDTEVTREWYQQTHEQQQQLNVLVLASSSTVVMQDESFPACKIEF dlg2_rat Disks large homolog 2 Dlg2 Postsynaptic density protein PSD-93 Channel-associated protein of synapse-110 Dlgh2 protein protein rat Rattus norvegicus (Rat) Rat MFFACYCALRTNVKKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLGLLPDSDMTSHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVILDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGDDGYGTKTLRGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL dlg1_rat Disks large homolog 1 Dlg1 Synapse-associated protein 97 Dlgh1 protein protein rat Rattus norvegicus (Rat) Rat MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPGNPWESGSLSSAAVTSESLPGGLSPPVEKYRYQDEEVLPSERISPQVPNEVLGPELVHVSEKSLSEIENVHGFVSHSHISPIKPTEAVPPSSPIVPVTPALPVPAESPVVLPSTPQANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRKAFRKNHEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKAAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSYLGQTPASPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLRETMMNSSVSSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYHEYGCSKGGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTDEQARKTFERAVRLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGPYIWVPAKEKL nos1_rat Nitric oxide synthase, brain Nos1 Bnos BNOS NOS type I Neuronal NOS Constitutive NOS NC-NOS Peptidyl-cysteine S-nitrosylase NOS1 protein protein rat Rattus norvegicus (Rat) Rat MEENTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPSASKDQSLAVDRVTGLGNGPQHAQGHGQGAGSVSQANGVAIDPTMKSTKANLQDIGEHDELLKEIEPVLSILNSGSKATNRGGPAKAEMKDTGIQVDRDLDGKSHKAPPLGGDNDRVFNDLWGKDNVPVILNNPYSEKEQSPTSGKQSPTKNGSPSRCPRFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLPSQHTRKPEDVRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHAFDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKSYKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKPNNSLISNDRSWKRNKFRLTYVAEAPDLTQGLSNVHKKRVSAARLLSRQNLQSPKFSRSTIFVRLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWKDESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKWGKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTRDGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPKKYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVFISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDADEVFSS kcna4_human Potassium voltage-gated channel subfamily A member 4 Voltage-gated potassium channel subunit Kv1.4 HPCN2 Voltage-gated potassium channel HK1 Voltage-gated potassium channel HBK4 KCNA4 KCNA4L Voltage-gated K(+) channel HuKII protein protein human Homo sapiens Human MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGGSHHHHQSRGACTSHDPQSSRGSRRRRRQRSEKKKAHYRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEDDHGDECSYTDLLPQDEGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHGGLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV nmde2_rat Glutamate receptor ionotropic, NMDA 2B Grin2b Glutamate [NMDA] receptor subunit epsilon-2 N-methyl D-aspartate receptor subtype 2B protein protein rat Rattus norvegicus (Rat) Rat MKPSAECCSPKFWLVLAVLAVSGSKARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFHHLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTLTPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSISKKPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGTGEKHGVVGGVPAPWEKNLTNVDWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVTSNASSTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMPAGESSFANKSSVPTAGHHHNNPGSGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKTRPDFRALVTNKPVVVTLHGAVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV apc_rat Adenomatous polyposis coli protein Apc protein protein rat Rattus norvegicus (Rat) Rat MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTELETEASNMKEVLKQLQGSIEDETMTSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRAFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAEAERSSQSKHETASHEAERQLEGQGVAESNLATSGSGQSSAARVDHETAGVLSSSGTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMHGLTDDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDASRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSTYHSATENPGTSSKRGLQLSATAAQIAKVMEEVSALHTSQDDRSPASAAELHCVAEERTAARRSSASHTHPNTHNFAKSESSNRTCSMPYAKVEYKRSSNDSLNSVTSSDGYGKRGQMKPSVESYSEDDEGKFCSYGQYPADLAHKIHSANHMDDNGGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQSRSQNTNFPVYSENTDDKHLKFQQHFGQQECVSPYRSRGTNGSETNRMGSSHAVNQNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKTPSVQGTKTEHNSPSSEAASAPSSNAKRQSQLHPSSAQRNGQTPKGTACKVPSINQETMQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKENDVTRSAQDPASDVPAVSQSTRTKPSRLQASGLASESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIVSPSDLPDSPGQTMPPSRSKTPPPPPPPQPVQTKREVPKTKVPAAEQREGGPKQTAVSAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETEPEQPEESNENQDKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPSQSRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGDGVRASVQSGEFEKRDTIPTEGRSTDEAQRGKVSSIAIPDLDGSKAEEGDILAECINSALPKGRSHKPFRVKKIMDQVQQASMTSSGTNKNQIDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTEETFSDNKDSKKQSLKNNPKDLNDKLPDNEDRVRGGFTFDSPHHYAPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCHTEPSSSQQSARKAQASTKHPVNRGPSKPLLQEQPTFPQSSKDVPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDVDQENNNNEETGPVRDAEPANAQGQPGKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLRECISSAMPKKRRPSRLKGEGEWQSPRKVGSVLAEDLTLDLKDIQRPESEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGVSLGSPFHLTPDQEEKPFTSHKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGPVATTSPRGTKPAVKSELSPITRQTSHISGSNKGPSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISTPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLSKQTGLSKNASSIPRSESASKGLNQMNNSNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYSDGRPSKRHDIARSHSESPSRLPVNRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSVPGPRQMKENQVPTKGTWRKIKESEISPTNTVSQTTSSGAASGAESKTLIYQMAPAVSRTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSISEKGNPSIKDSKDTQGKQSVGSGSPVQTVGLENRLNSFIQVEAPEQKGTETKAGQGSPAPVAETGETCMAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVGSSTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV cript_rat Cysteine-rich PDZ-binding protein Cysteine-rich interactor of PDZ three Cript protein protein rat Rattus norvegicus (Rat) Rat MVCEKCEKKLGRVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV kcna4_rat Potassium voltage-gated channel subfamily A member 4 Voltage-gated potassium channel subunit Kv1.4 RCK4 RHK1 RK3 Kcna4 protein protein rat Rattus norvegicus (Rat) Rat MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGGPHHHHQTRGAYSSHDPQGSRGSREEEATRTEKKKKLHHRQSSFPHCSDLMPSGSEEKILRELSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVVINVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHLENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV map1a-dlg4-7 GST pull down : PSD-95 (DLG4) interacts with MAP1A 206955 N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gk c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false map1a-dlg2-1 GST pull down : PSD-93 (DLG2) interacts with MAP1A 206955 N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] N/A 206967 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false map1a-dlg1-1 GST pull down : SAP-97 (DLG1) interacts with MAP1A 206955 N/A 206968 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rat-brain Rattus norvegicus brain brain Brain [cerebrum] N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false nos1-dlg4-1 GST pull down : PSD-95 (DLG4) interacts with nNOS 206955 N/A 206969 unspecified role unspecified role prey prey N/A 206965 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false kcna4-dlg4-11 GST pull down : PSD-95 (DLG4) interacts with kv1.4 206955 N/A 206970 unspecified role unspecified role prey prey N/A 206965 unspecified role unspecified role bait bait pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Addition of the NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) inhibits the interaction. nmde2-dlg4-1 competition binding : PSD-95 (DLG4) interacts with NMDE2 c-terminus via PDZ domains 206956 N/A 206971 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q00960:p.Val1482Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 206965 unspecified role unspecified role bait bait pdz 1-2-3 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false apc-dlg4-1 competition binding : PSD-95 (DLG4) interacts with APC c-terminus 206956 N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206972 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false cript-dlg4-2 competition binding : PSD-95 (DLG4) interacts with CRIPT c-terminus 206956 N/A 206973 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false nmde2-dlg4-2 competition binding : PSD-95 (DLG4) interacts with NMDE2 c-terminus 206956 N/A 206971 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q00960:p.Val1482Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false kcna4-dlg4-12 competition binding : PSD-95 (DLG4) interacts with Kv1.4 c-terminus 206956 N/A 206974 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false map1a-dlg4-1 filter assay: PSD-95 interacts with MAP1A 206957 N/A 206966 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. map1a-dlg4-2 filter assay: PSD-95 interacts with MAP1A 206957 N/A 206966 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. map1a-dlg4-3 filter assay: PSD-95 interacts with MAP1A 206957 N/A 206966 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false The 3 clones identified in the expression cloning all encode overlapping region of MAP1A now called GK binding region. apc-dlg4-4 filter assay: PSD-95 interacts with APC 206957 N/A 206965 unspecified role unspecified role bait bait pdz domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 206972 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false direct interaction direct interaction false false false map1a-dlg4-11 Far western : PSD-95 (DLG4) interacts with MAP1A 206958 N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 206966 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 207054 207052 physical association physical association false false false map1a-dlg4-12 Far western : PSD-95 (DLG4) full length interacts with MAP1A 206958 N/A 206966 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206965 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. The interaction is stimulated by the binding of the following peptides to the PDZ domains which may release an intramolecular inhibition : NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482), or APC peptide (SGSYLVTSV APC_RAT 2834-2842), or Kv1.4 peptide (NAKAVETDV KCNA4_RAT 647-655) or CRIPT peptide (TKNYKQTSV Q792Q4 1474-1482). Presence of the PDZ domains in PSD-95 inhibits the interaction. It may be through intramolecular inhibition. map1a-dlg2-4 Far western : PSD-93 (DLG2) interacts with MAP1A 206958 N/A 206966 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206967 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false No interaction is detected unless NR2B peptide is added (KLSSIESDV NMDE2_RAT 1474-1482). NR2B by binding to PSD-93 PDZ domains may release an intramolecular inhibition. map1a-dlg1-2 Far western : SAP-97 (DLG1) interacts with MAP1A 206958 N/A 206966 unspecified role unspecified role prey prey gk binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206968 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false No interaction is detected unless NR2B peptide is added (KLSSIESDV NMDE2_RAT 1474-1482). NR2B by binding to SAP-97 PDZ domains may release an intramolecular inhibition. map1a-dlg4-4 Quantitative overlay assay : PSD-95 GK domain interacts with MAP1A 206959 N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 206966 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false map1a-dlg4-10 Quantitative overlay assay : PSD-95 interacts with MAP1A 206959 N/A 206966 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 206965 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. PDZ domains of PSD-95 full-length inhibit the interaction. The interaction is stimulated by binding of NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) to the PDZ domains. map1a-dlg4-8 far western : PSD-95 (DLG4) GK domain interacts with MAP1A 206960 N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false map1a-dlg4-9 far western : PSD-95 (DLG4) interacts with MAP1A 206960 N/A 206965 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false Interaction of MAP1A with PSD-95 full-length can be detected only if other proteins bind to its PDZ domains. PSD-95 GK domain alone binds MAP1A. PDZ domains of PSD-95 full-length inhibit the interaction. The interaction is stimulated by binding of NR2B peptide (KLSSIESDV NMDE2_RAT 1474-1482) to the PDZ domains. map1a-dlg4-5 Far western : PSD-95 GK domain interacts with immunoprecipitated MAP1A 206961 N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] direct interaction direct interaction false false false map1a-dlg4-6 Y2H: PSD-95 interacts with MAP1A 206962 N/A 206966 unspecified role unspecified role prey prey gk binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 206965 unspecified role unspecified role bait bait gk domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false gk c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gk n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false map1a-dlg2-2 colocalization in rat brain of PSD-93 (DLG2) and MAP1A 206963 N/A 206967 unspecified role unspecified role neutral component neutral component N/A 206966 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false MAP1A and PSD-93 colocalize in profiles in Purkinje neurones in cerebellum and the CA3 region of hippocampus map1a-dlg2-3 CoIP of PSD-93 (DLG2) and MAP1A in rat brain 206964 N/A 206967 unspecified role unspecified role bait bait rat-brain Rattus norvegicus brain brain Brain [cerebrum] N/A 206966 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association false false false