IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ d_souza_sch-1997-2 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). Fig. 6 schorey@cellbio.wustl.edu EMBO J. (0261-4189) 1997 d_souza_sch-1997-3 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu EMBO J. (0261-4189) 1997 d_souza_sch-1997-1 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western D'Souza-Schorey C., Boshans RL., McDonough M., Stahl PD., Van Aelst L. Synapse - Interactions of proteins with an established role in the presynapse. The ARF6-GST fusion protein was loaded with either GTP-gammaS or GDP-betaS (non-hydrolyzable analogs of GTP and GDP respectively). schorey@cellbio.wustl.edu EMBO J. (0261-4189) 1997 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS arfp2_human Arfaptin-2 ADP-ribosylation factor-interacting protein 2 Partner of RAC1 ARFIP2 POR1 protein protein human Homo sapiens Human MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL arf3_human ADP-ribosylation factor 3 ARF3 protein protein human Homo sapiens Human MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK arf6-arfip2-2 Interaction between ARF6 and POR1 detected by yeast two-hybrid. 209219 N/A 209222 unspecified role unspecified role bait bait P62330:p.Thr28Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209223 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rac1-arfip2-1 Interaction of Rac1 and POR1 detected by yeast two hybrid. 209219 N/A 209224 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209223 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false arfip2-arf6-3 ARF6 binds to the C-terminus of POR1, as detected by yeast two hybrid. 209219 N/A 209223 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209222 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ARF6 also contains a gln67leu mutation which results in it being GTPase-defective. However this does not appear to effect binding to POR1. arf3-arfip2-1 Interaction of ARF3 and POR1, as detected by yeast two hybrid. 209219 N/A 209223 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209225 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ARF3 also contained the mutation gln71leu, which resulted in it being GTP-defective. rac1-arfip2 Interaction between RAC1 and POR1 detected by liquid beta-dalactosidase assay. 209220 N/A 209223 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209224 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The strength of this interaction was measured at 75 +/- 1.1 Miller units. Rac1 possessed a gly12val mutation, producing an activation mutant. arf6-arfip2-3 Interaction between ARF6 and POR1 detected by liquid beta-dalactosidase assay. 209220 N/A 209222 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 209223 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false The strength of this interaction was measured at 71 +/- 1.5 Miller units. Arf6 possessed a gln67leu mutation, producing a mutant defective in GTPase activity. arf6-arfip2-1 ARF6 interacts with POR1, as detected by gst pull down. 209221 N/A 209222 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 209223 unspecified role unspecified role prey prey mbp-tag region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false POR1 (P53365) bound preferentially to the GTP-bound form of ARF6 (P62330).