IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhu-2009-7 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-8 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-1 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-5 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag visualisation tag visualisation Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. HA tagged proteins were visualised by immunostaining. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-9 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. Cells used were from A-5RT3(CTRL) and A-5RT3 (ANGPTL4) tumour biopsies. The former line contains a stably integrated non-targeting scrambled siRNA, as a control line, and the A-5RT3 (ANGPTL4) line contains an siRNA targeting a segment of the ANGPTL4 sequence. As a result mRNA and protein levels of ANGPTL4 were suppressed by >85% in the A-5RT3 (ANGPTL4) cell line, as compared to the control line. The authors confirm that integrins beta-1 and beta 5 were of human origin. Details of ANGPTL4 were obtained from Goh et al.,JBC 285, 2010. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-3 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. The main body of the paper states that this co-ip was carried out in HEK293 cells, whereas the figure legend states they were obtained in HEK293T cells. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-4 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation zhu-2009-6 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Zhu GD., Salazar G., Zlatic SA., Fiza B., Doucette MM., Heilman CJ., Levey AI., Faundez V., L'hernault SW. Synapse - Interactions of proteins with an established role in the presynapse. bioslh@biology.emory.edu, faundez@cellbio.emory.edu. Mol. Biol. Cell (1059-1524) 2009 Only protein-protein interactions imex curation vp33b_human Vacuolar protein sorting-associated protein 33B VPS33B protein protein human Homo sapiens Human MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVNADKLAGRTRKYKVIFSPQKFYACEMVLEEEGIYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTTAVTNSARLMEAMSEVKA vps41_human Vacuolar protein sorting-associated protein 41 homolog VPS41 S53 protein protein human Homo sapiens Human MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSSCKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVSPRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQKILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEMKK spe39_human Spermatogenesis-defective protein 39 homolog VIPAS39 C14orf133 SPE39 VIPAR VPS33B-interacting protein in apical-basolateral polarity regulator VPS33B-interacting protein in polarity and apical restriction protein protein human Homo sapiens Human MNRTKGDEEEYWNSSKFKAFTFDDEDDELSQLKESKRAVNSLRDFVDDDDDDDLERVSWSGEPVGSISWSIRETAGNSGSTHEGREQLKSRNSFSSYAQLPKPTSTYSLSSFFRGRTRPGSFQSLSDALSDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDRTEELALSHYREHLNIQDPDKRKEFLKTCVGLPFSAEDSAHIQDHYTLLERQIIIEANDRHLESAGQTEIFRKHPRKASILNMPLVTTLFYSCFYHYTEAEGTFSSPVNLKKTFKIPDKQYVLTALAARAKLRAWNDVDALFTTKNWLGYTKKRAPIGFHRVVEILHKNNAPVQILQEYVNLVEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKIDALLSSSQIRWKN vps11_mouse Vacuolar protein sorting-associated protein 11 homolog Vps11 protein protein mouse Mus musculus Mouse MAAYLQWRRFVFFEKELVKEPLGNDGAAPGAAPVSGSAASKFLCLPPGITVCDSGRGSLVFGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEKRDGGNPLCTRIFPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSDPSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIVHWFRGYLVIVSRDRKVSPKSEFTSRDSQNSDKQILNIYDLCNKFIAYSAGFEDIVDVLAEWGSLYVLTRDGRVHALQEKDTQTKLEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEPSYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKTKSESEVHFDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQAESNMKRYGKTLMHHIPEQTTQLLKGLCTDYRPSLEGRGDREALSCRASSEEFIPIFANNPRELKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQAKEKLHAEAISLLKSGRFCDVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVIAVCERHGEQEPSLWEQALSYFARKEEDCKEYVAAVLRHIENKSLMPPLLVVQTLAHNSTATLSIIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTPSLEAGLQRDLLMHSRRGT vps16_mouse Vacuolar protein sorting-associated protein 16 homolog Vps16 protein protein mouse Mus musculus Mouse MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELKDCLVAAAPYGGPIALLRNCWRKEKAASVRPVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSANVGDLKLRRMPEVPGLQSAPSCWTTLCHDRVPHILLAVGPDLYLLDHATCSAVTPAGLAPGVSSFLQMAVSFTYRYLALFTDTGYIWMGTASLKEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREIQELGQLIQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAIRDYHIGIPLTYTQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKARAWDMRDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRIQRRLEDELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKHEAKKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLSHCTGATDGAIADKIQRARAQAQKK vps18_mouse Vacuolar protein sorting-associated protein 18 homolog Vps18 protein protein mouse Mus musculus Mouse MASILDEYEDSLSRSAVLQTGCPSVGIPHSGYVSAHLEKEVPIFTKQRVDFTPSERITSLVVSCNQLCMSLGKDTLLRIDLGKASEPNRVELGRKDDAKVHKMFLDHTGSHLLVALSSTEVLYMNRNGQKARPLARWKGQLVESVGWNKAMGNESSTGPILVGTAQGQIFEAELSASEGGLFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRGFVIATTRQRLFQFIGRAVEDTEAQGFAGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGSLDCGRPDSLLSEERVWEYPAGVGPGANPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFLEKFGPLRHMVKDSSTGHLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPDCLDTVLAREADFCFRQHRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLAGLKPTERTQATLLTTWLTELYLSRLGALQGDPDALTLYRDTRECFRTFLSSPRHKEWLFASRASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSPILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEAQQVSQAIRYMEFCVNVLGETEQAIHNYLLSLYARGQPASLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVLELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASCPLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQELRGRYGTVEPQDKCSTCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPTKGSVKAKEAEAGAAAVGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEHLSWL vps39_mouse Vam6/Vps39-like protein Vps39 Pldn Vam6 protein protein mouse Mus musculus Mouse MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAVRKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIVAVLPRYVEIRTLEPRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPTLSGAELEKAHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLNFLIENFKALAIPYLEHIIHVWEETGSQFHNCLIQLYCEKVQSLMKDYLLSLPTGKSPVPAGEEGGELGEYRQKLLMFLEISSHYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHVLKDTKMAKEYCHKHYDQNKEGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPQANLQAALQVLELHYSKLDTTKAINLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNSADT vp33a_caeel Vacuolar protein sorting-associated protein 33A vps-33.1 B0303.9 slp-1 Protein slp-1 protein protein caeel Caenorhabditis elegans MAANEDRDDAAAILNWEGTSEIKSANEYSRNLLFSVLDSLDGNKTIVWDRDRSVMHRVNLFAGASVLAAHGVVANHSIETKKSASTPHVVFFLAPTMVSLDLLCDYIDNVRNDSKILYQVFFIPEAWFVVRESLKTRAEGKYWERLESVKEIPLCWLPRDGECLSLSSPQIAARLLINGDWTHLHKCAVALNQLIDMCRGRSSSSNQRPMSIYAKGKWASDVAKMMGKIRNSAEADSMTKNLDPIEGLLKINRIVLIDRWMDPLTPMLSQLTFYGLLDEIYGIGMVNSVKVPEMEFKNEKDGDPFQEKEVYLIDEVYHRLKHSHINAVSIEASKVLAEIRDDEQFDRDKMSVAEYSVLVKKMPKIINRKKMIEVHMRLAEMIQSHVYCKQSDSIKLERDLLEYSDSDKAIPLIEDLIFDASPLNAVLRLISVHSLTCGGLKPSVLQHYRRIVNQSYGSSALNKVLKMQKMGLIREKGGGGKMQCEYAQMMFQQMKKNHDMLPEEFSEAKLDDMAYAYSGFSPLLCKMLEEGDRVKWVGWPKTVIGDKSDLIAERDGRGTCVFVIGGLTRSELAIIRENLPNVALITTSALITGDKLLNNITNI spe39_caeel Spermatogenesis-defective protein 39 vipar spe-39 ZC404.3 VPS33B-interacting protein in polarity and apical restriction protein protein caeel Caenorhabditis elegans MALRRKFTFELPEDSYWNESDSNSSGLFDDLQSKQLQARAAVDNLFGGDETPKPYVRPQNPTPTPTNVPLQIDGRAAAVSDKANIRITDTSPRASGKIVDDFLNMKFAENVNVAPVIQTAPSVVSEASASSLPSEAQRLDLDYNRLRQEHRKLKDQHEVLRHERFQPLTIEASIKRMLQGHTVTLDYYRSLRDKTQLLKQAVATYDNNTIFKIVIFLERTLKENIFCKIMDGQKSACRVYTRHLQITGEWDKMNKFLRSIGQYQHASVIEFEATRKYKRNPDKRVPLLRTMLHGSFSIPEMKFEARQMEALMRNYEIQLQMEKMDAGDKGEHFRKFPKTSSLIGLPALSSLYYSAMYHYDDSPTSAASLPSVQTLIRFNDRLATQTIVSALTRLSRWPDIDKLLQPKTITMTFSAAKSVFKGKKSTSKWGVSINNHNLLTIVKRSHPSPPTDFIYRILKGESDAQERLRLALLFDVPEMVIECLTQKGDRLSLASYAKSLKTNSVESFKAVAALNNPSIKWK vp33b_caeel Vacuolar protein sorting-associated protein 33B C56C10.1 vps-33.2 protein protein caeel Caenorhabditis elegans MAPGTAELEIDETLHLLRMVMQREFIHYLETLPGTKELFIDKCLLRPLDMIATSSDMKRHGVKRIMHFDLQKSPQVWNIEIDQRVFFLRPNVENARKIVEYVEESSENRSICVIWCNRQLEECDLAFESSGVIGHITQLSLNMCLLPLESDLFSLQHVESAQPDLFSVANMFVALQNLYGVIPTVYGLGSESKNLWNLVHALCSSNELRARPDQPISHLFLFDRQLDPVPVLLTGASYEGLLHEFFTIDCGKLAFPVDLRKQVQTGPLDFDWIEINPEEDKEAHQQNRGDTVKLDNCEDIFASIRNKHVTAALEFLHSKAKSIQKSIEKSSMIDDVADYRNFVEKDLRALKKDHKHCELHINACEMMMNKVKMEDYRTMFKLEHEMLLGTVTHEEYFDFVFERVPMRSCRDVVLSMMSLASLKLDGVPDDTYNEFVEMYLQKYGYEHMFELQNLRNSRVIYARRHIAHDRTISERARTWETLARKFRIVKGNEPMDMSNPSDMSYVFGARISPLLCKIVEDTIDHGWNQAEYERIIGKDKVLVEENTYIAADRRPDNRTRKAIMVFVNGGITYWEVAALRLLAIQKNFRILICTTHVIKKREYLEVRAKDASSVFGS vp33a_human Vacuolar protein sorting-associated protein 33A VPS33A protein protein human Homo sapiens Human MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF c14orf133-vps41 871597 n/a 871605 unspecified role unspecified role prey prey n/a 871606 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A. c14orf133-vps11-2 871597 n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871608 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary fig 4A. c14orf133-vps16 871597 n/a 871609 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey association association false false false Fig 6A. c14orf133-vps18 871597 n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey n/a 871610 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A. c14orf133-vps39 871597 n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871611 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey association association false false false Fig 6A. c14orf133-vps11 871597 n/a 871605 unspecified role unspecified role prey prey n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871608 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6A. c14orf133-vps16-2 871597 n/a 871609 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary fig 4A. c14orf133-vps18-3 871597 n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871610 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary fig 4A. c14orf133-vps41-2 871597 n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871606 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary fig 4A. c14orf133-vps11-1 871598 n/a 871605 unspecified role unspecified role prey prey n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871608 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6B. c14orf133-vps18-2 871598 n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871610 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Fig 4B. c14orf133-vps16-1 871598 n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871609 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey association association false false false Fig 6B. c14orf133-vps18-1 871598 n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey n/a 871610 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6B. c13orf133-vps41 871598 n/a 871605 unspecified role unspecified role prey prey n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871606 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6B. c14orf133-vps41-1 871598 n/a 871607 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871606 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary Fig 4B. spe-39-slp-1 871599 n/a 871612 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) n/a 871613 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig 2. spe-39-vps-33-2 871599 n/a 871614 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) n/a 871613 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig 2. vps33b-c14orf133-2 871600 n/a 871605 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 4 C-J. vps33a-c14orf133 871600 n/a 871615 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig 4 C-J. something should be added here, I think... vps33b-c14orf133 871601 n/a 871607 unspecified role unspecified role bait bait n/a 871605 unspecified role unspecified role prey prey physical association physical association false false false Fig 4A. vps33b-c14orf133-1 871602 n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871605 unspecified role unspecified role prey prey physical association physical association false false false Supplemental Fig 3. vps33a-c14orf133-1 871603 n/a 871615 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 4B. vps-c14orf133 871604 n/a 871609 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871610 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 871607 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 5.