IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ suzuki-2008-1 Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation. rat-rbl_2h3 Rat basophilic leukemia cell line rbl_2h3 Rat basophilic leukemia cell line density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Suzuki K., Verma IM. Synapse - Interactions of proteins with an established role in the presynapse. Samples pre-fractionated by sucrose density gradient centrifugation verma@salk.edu Fcepsilon R1 (P30273) stimulation Cell (0092-8674) 2008 Only protein-protein interactions 6 imex curation suzuki-2008-2 Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation. rat-rbl_2h3 Rat basophilic leukemia cell line rbl_2h3 Rat basophilic leukemia cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki K., Verma IM. Synapse - Interactions of proteins with an established role in the presynapse. Samples pre-fractionated by sucrose density gradient centrifugation verma@salk.edu Fcepsilon R1 (P30273) stimulation Cell (0092-8674) 2008 Only protein-protein interactions 6 imex curation suzuki-2008-3 Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Suzuki K., Verma IM. Synapse - Interactions of proteins with an established role in the presynapse. Samples pre-fractionated by sucrose density gradient centrifugation verma@salk.edu Fcepsilon R1 (P30273) stimulation Cell (0092-8674) 2008 Only protein-protein interactions 6 imex curation suzuki-2008-4 Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation. mouse-mast_cell Mouse mast cell mast_cell Mast cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Suzuki K., Verma IM. Synapse - Interactions of proteins with an established role in the presynapse. Samples pre-fractionated by sucrose density gradient centrifugation verma@salk.edu Fcepsilon R1 (P30273) stimulation Cell (0092-8674) 2008 Only protein-protein interactions 6 imex curation suzuki-2008-5 Phosphorylation of SNAP-23 by IkappaB kinase 2 regulates mast cell degranulation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Suzuki K., Verma IM. Synapse - Interactions of proteins with an established role in the presynapse. Samples pre-fractionated by sucrose density gradient centrifugation Source of IKK2 confirmed by author. verma@salk.edu Fcepsilon R1 (P30273) stimulation Cell (0092-8674) 2008 Only protein-protein interactions 6 imex curation vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST snp23_rat Synaptosomal-associated protein 23 Snap23 Vesicle-membrane fusion protein SNAP-23 protein protein rat Rattus norvegicus (Rat) Rat MDDLSPEEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCVCPCNRTKNFESGKNYKATWGDGGDSSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLIDS stx4_rat Syntaxin-4 Stx4 Stx4a protein protein rat Rattus norvegicus (Rat) Rat MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLSSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG ikkb_rat Inhibitor of nuclear factor kappa-B kinase subunit beta Ikbkb Ikkb I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein rat Rattus norvegicus (Rat) Rat MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQVTGEQIAIKQCRQELSPKNRDRWCLEIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSSPFPNNLNSVLAERLEKWLQLMLTWQPRQRGVDPQYGPNGCFRALDDILNLKLVHILNMVTGTIHTYPVMEDESLQSLKTRIREDTGILETDQELLQEAGLVLLPDKPATQCISDSKTNEGLTLDMDLVFLFDNSKMSYETQITPRPQPESVSCVLQEPKRNLSFFQMRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNAMASTAQQLKAKLDFFKTSIQIDLEKYREQTEFGITSDKLLLAWREMEQAVEQCGRENDVKVLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQDMVRLLLQAIQSFEKKVRVIYSQLSKTVVCKQKALELLPKVEEVVRLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNVSRLSHPGHLMSQPSSACDSLPDSDKKSEELVAEAHALCSRLESALQDTVKQQDRSFTTLDWSWLQMEDEERCGLEQACD snp23_mouse Synaptosomal-associated protein 23 Snap23 Sndt Vesicle-membrane fusion protein SNAP-23 Syndet protein protein mouse Mus musculus Mouse MDNLSPEEVQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLIDS ikkb_human Inhibitor of nuclear factor kappa-B kinase subunit beta IKBKB IKKB I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Serine/threonine protein kinase IKBKB protein protein human Homo sapiens Human MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEEDQELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST vamp8_mouse Vesicle-associated membrane protein 8 Vamp8 Endobrevin protein protein mouse Mus musculus Mouse MEEASGSAGNDRVRNLQSEVEGVKNIMTQNVERILSRGENLDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIIVILIILFATGTIPT stx4_mouse Syntaxin-4 Stx4 Stx4a protein protein mouse Mus musculus Mouse MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG ikkb_mouse Inhibitor of nuclear factor kappa-B kinase subunit beta I-kappa-B kinase 2 Nuclear factor NF-kappa-B inhibitor kinase beta Ikbkb Ikkb Serine/threonine protein kinase IKBKB protein protein mouse Mus musculus Mouse MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQATGEQIAIKQCRQELSPKNRNRWCLEIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREGAVLTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEKRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGAVKFSSSLPFPNNLNSVLAERLEKWLQLMLMWHPRQRGTDPQYGPNGCFRALDDILNLKLVHVLNMVTGTVHTYPVTEDESLQSLKTRIQENTGILETDQELLQKAGLVLLPDKPATQCISDSKTNEGLTLDMDLVFLLDNSKINYETQITPRPPPESVSCILQEPKRNLSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMSLLRNNSCLSKMKNAMASTAQQLKAKLDFFKTSIQIDLEKYKEQTEFGITSDKLLLAWREMEQAVEQCGRENDVKHLVERMMALQTDIVDLQRSPMGRKQGGTLDDLEEQARELYRKLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDERTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPESDKKSEELVAEAHALCSRLESALQDTVKEQDRSFTTLDWSWLQMEDEERCSLEQACD snap23-stx4-1 Cosedimentation of SNAP23 and STX4 from lipid rafts - no stimulation 765860 N/A 765865 unspecified role unspecified role neutral component neutral component N/A 765866 unspecified role unspecified role neutral component neutral component N/A 765867 unspecified role unspecified role neutral component neutral component physical association physical association false false false Lipid rafts identified by the cross-linking of glycosphingolipid GM1 with choleratoxin B subunit (CTx) Fig. 4A No snap23-stx4-2 Cosedimentation of SNAP23 and STX4 from lipid rafts - stimulation via the Fc receptor 765860 N/A 765867 unspecified role unspecified role neutral component neutral component N/A 765868 unspecified role unspecified role neutral component neutral component N/A 765866 unspecified role unspecified role neutral component neutral component N/A 765865 unspecified role unspecified role neutral component neutral component physical association physical association false false false Lipid rafts identified by the cross-linking of glycosphingolipid GM1 with choleratoxin B subunit (CTx) Fig. 4A Yes snap23-ikbk-1 Coimmunoprecipitation of SNAP23 and IKBKB (IKK2) 765861 N/A-x 765868 unspecified role unspecified role prey prey N/A-x-x 765866 unspecified role unspecified role bait bait physical association physical association false false false Lipid rafts identified by the cross-linking of glycosphingolipid GM1 with choleratoxin B subunit (CTx) Fig. 4C FC epsilon RI stimulation ikbkb-snap23-1 Phosphorylation of SNAP-23 by IKBKB 765862 N/A 765869 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O09044:p.[Ser95Ala;Ser120Ala] Alters kinetics of interaction mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 765870 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm phosphorylation phosphorylation reaction phosphorylation false false false Phosphorylation of SNAP-23 (O09044) on Ser120 and Ser95 Fig. 5A snap23-stx4-3 Interaction between SNAP23 and STX4 identified by cosedimentation 765863 N/A 765871 unspecified role unspecified role neutral component neutral component N/A 765869 unspecified role unspecified role neutral component neutral component N/A 765872 unspecified role unspecified role neutral component neutral component N/A 765873 unspecified role unspecified role neutral component neutral component association association false false false Fig. 5D Interaction does not occur in IKBKB -/- mast cells Fcepsilon RI stimulation ikbkb-snap23-2 Interaction between SNAP23 and IKBKB identified by coimmunoprecipitation 765864 n/a 765874 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 765869 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4B