IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mistry-2007-5 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. Origin of synaptotagmin 1, SNAP-25, SNAP-23, and syntaxin-4 supplied by the author jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-3 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-6 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. MDCK cells are stably infected with rat Slc14a2 jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-1 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-2 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-4 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation mistry-2007-7 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein. canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line confocal microscopy confocal microscopy immunostaining immunostaining Mistry AC., Mallick R., Frohlich O., Klein JD., Rehm A., Chen G., Sands JM. Synapse - Interactions of proteins with an established role in the presynapse. MDCK cells are stably infected with rat Slc14a2. SNAPAP was detected by tag fluorescence. jsands@emory.edu Human kidney cDNA J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation q62668-1 Urea transporter 2 UT-A1 Slc14a2 Ut2 Solute carrier family 14 member 2 Urea transporter, kidney protein protein rat Rattus norvegicus (Rat) Rat MSDHPLKEMSDNNRSPPLPEPLSSRYKLYESELSSPTWPSSSQDTHPALPLLEMPEEKDLRSSDEDSHIVKIEKPNERSKRRESELPRRASAGRGAFSLFQAVSYLTGDMKECKNWLKDKPLVLQFLDWVLRGAAQVMFVNNPLSGLIIFIGLLIQNPWWTIAGALGTVVSTLAALALSQDRSAIASGLHGYNGMLVGLLVAVFSEKLDYYWWLLFPVTFASMACPVISSALSTVFAKWDLPVFTLPFNIALTLYLAATGHYNLFFPTTLVKPASSAPNITWSEIEMPLLLQTIPVGVGQVYGCDNPWTGGVILVALFISSPLICLHAAIGSIVGLLAALTVATPFETIYTGLWSYNCVLSCVAIGGMFYVLTWQTHLLALVCALFCAYTGAALSNMMAVVGVPPGTWAFCLSTLTFLLLTSNNPGIHKLPLSKVTYPEANRIYFLTAKRSDEQKPPNGGGGEQSHGGGQRKAEEGSETVFPRRKSVFHIEWSSIRRRSKVFGKSEHQERQTKEPLPYLYRKPTVELLDLNTMEESSEIKVETNTTRTTWIQSSMIAGGKRVSKALSYITGEMKECGEGLKDKSPVFQFLDWVLRGTSQVMFVNNPLSGILIVLGLFVQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGLHGYNGVLVGLLMAVFSDKGNYYWWLLLPVIVMSMTCPILSSALSTVFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTKLLQPAVTTPNITWSDVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLVALFVSSPLICLHAAIGSTIGMLAALSIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALFAAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPGIYKLPLSKVTYPEANRIYFLSQEKNRRASMITKYQAYDVS snapn_human SNARE-associated protein Snapin SNAPIN SNAP25BP SNAPAP Synaptosomal-associated protein 25-binding protein BLOC1S7 Biogenesis of lysosome-related organelles complex 1 subunit 7 protein protein human Homo sapiens Human MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK stx4_rat Syntaxin-4 Stx4 Stx4a protein protein rat Rattus norvegicus (Rat) Rat MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLSSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVSVTVLILAVIIGITITVG snp23_rat Synaptosomal-associated protein 23 Snap23 Vesicle-membrane fusion protein SNAP-23 protein protein rat Rattus norvegicus (Rat) Rat MDDLSPEEIQLRAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCVCPCNRTKNFESGKNYKATWGDGGDSSPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLIDS ut2_rat Urea transporter 2 Slc14a2 Ut2 Urea transporter, kidney Solute carrier family 14 member 2 protein protein rat Rattus norvegicus (Rat) Rat MSDHPLKEMSDNNRSPPLPEPLSSRYKLYESELSSPTWPSSSQDTHPALPLLEMPEEKDLRSSDEDSHIVKIEKPNERSKRRESELPRRASAGRGAFSLFQAVSYLTGDMKECKNWLKDKPLVLQFLDWVLRGAAQVMFVNNPLSGLIIFIGLLIQNPWWTIAGALGTVVSTLAALALSQDRSAIASGLHGYNGMLVGLLVAVFSEKLDYYWWLLFPVTFASMACPVISSALSTVFAKWDLPVFTLPFNIALTLYLAATGHYNLFFPTTLVKPASSAPNITWSEIEMPLLLQTIPVGVGQVYGCDNPWTGGVILVALFISSPLICLHAAIGSIVGLLAALTVATPFETIYTGLWSYNCVLSCVAIGGMFYVLTWQTHLLALVCALFCAYTGAALSNMMAVVGVPPGTWAFCLSTLTFLLLTSNNPGIHKLPLSKVTYPEANRIYFLTAKRSDEQKPPNGGGGEQSHGGGQRKAEEGSETVFPRRKSVFHIEWSSIRRRSKVFGKSEHQERQTKEPLPYLYRKPTVELLDLNTMEESSEIKVETNTTRTTWIQSSMIAGGKRVSKALSYITGEMKECGEGLKDKSPVFQFLDWVLRGTSQVMFVNNPLSGILIVLGLFVQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGLHGYNGVLVGLLMAVFSDKGNYYWWLLLPVIVMSMTCPILSSALSTVFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTKLLQPAVTTPNITWSDVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLVALFVSSPLICLHAAIGSTIGMLAALSIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALFAAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPGIYKLPLSKVTYPEANRIYFLSQEKNRRASMITKYQAYDVS e2r9t5_canlf Biogenesis of lysosome-related organelles complex 1 subunit 7 SNAPIN protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MTVTEREREEETQAEGEAGSMHREPDVGLDPGSPGSRPGPKAGAKPLRHPGIPFSGSFAININFTSVRCQNALFSKLQTQLFFFFFKPRSGGPGPRPRPRRRGFPEVPRPRPAGSSPAPPGGALQRNSSSRRPARQFPAEGLLVMAAAGSAAVSGAGTPVAGPAGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGLYPPGSPSK syt1_human Synaptotagmin-1 Synaptotagmin I p65 SYT1 SYT SVP65 protein protein human Homo sapiens Human MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELHKIPLPPWALIAIAIVAVLLVLTCCFCICKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK snp25_human Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein SNAP25 SNAP protein protein human Homo sapiens Human MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG snp23_human Synaptosomal-associated protein 23 Vesicle-membrane fusion protein SNAP-23 SNAP23 protein protein human Homo sapiens Human MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLIDS stx4_human Syntaxin-4 Renal carcinoma antigen NY-REN-31 STX4 STX4A protein protein human Homo sapiens Human MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG q15849-1 Urea transporter 2 UT-A1 SLC14A2 HUT2 UT2 Solute carrier family 14 member 2 Urea transporter, kidney protein protein human Homo sapiens Human MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQVMFINNPLSGLIIFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASGLHGYNGMLVGLLMAVFSEKLDYYWWLLFPVTFTAMSCPVLSSALNSIFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMPLLLQAIPVGVGQVYGCDNPWTGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNCVLSCIAIGGMFYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIFRLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGFHGYNGVLVGLLMAVFSDKGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTLPFNITVTLYLAATGHYNLFFPTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIALFISSPLICLHAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALFAAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYLSQERNRRASIITKYQAYDVS slc14a2-snapap-6 Interaction between rat SLC14A2 and human SNAPAP identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey rat-kidney_inner_med Rat kidney inner medulla kidney_inner_medulla Kidney inner medulla N/A 693725 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2C slc14a2-snapap-7 Interaction between rat SLC14A2 and human SNAPAP identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693725 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 3 slc14a2-snapap-8 Interaction between SLC14A2 and SNAPAP identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693725 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 5 MDCK cell line stably expresses rat SLC14A2 Q62668 infection slc14a2-snapap-12 Interaction between SLC14A2, Ut2, SNAP23 and SNAPAP identified by pull down 693717 N/A 693726 unspecified role unspecified role prey prey rat-kidney_inner_med Rat kidney inner medulla kidney_inner_medulla Kidney inner medulla N/A 693725 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 693727 unspecified role unspecified role prey prey rat-kidney_inner_med Rat kidney inner medulla kidney_inner_medulla Kidney inner medulla N/A 693728 unspecified role unspecified role prey prey rat-kidney_inner_med Rat kidney inner medulla kidney_inner_medulla Kidney inner medulla association association false false false Fig. 9 slc14a2-syt1-1 Interaction between SLC14A2, SNAPAP and SYT1 identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693729 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693730 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) association association false false false Fig. 5 MDCK cell line stably expresses rat SLC14A2 Q62668 infection slc14a2-snap25-1 Interaction between SLC14A2, SNAPAP and SNAP25 identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693729 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693731 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) association association false false false Fig. 5 MDCK cell line stably expresses rat SLC14A2 Q62668 infection slc14a2-snap23-1 Interaction between SLC14A2, SNAPAP and SNAP23 identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693729 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693732 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) association association false false false Fig. 5 MDCK cell line stably expresses rat SLC14A2 Q62668 infection slc14a2-stx4-1 Interaction between SLC14A2, SNAPAP and STX4 identified by pull down 693717 N/A 693724 unspecified role unspecified role prey prey N/A 693729 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line N/A 693733 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) association association false false false Fig. 5 MDCK cell line stably expresses rat SLC14A2 Q62668 infection slc14a2-snapap-3 Interaction between SLC14A2 and SNAPAP identified by coimmunoprecipitation 693718 N/A 693734 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 693725 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A slc14a2-snapap-4 Interaction between SLC14A2 and SNAPAP identified by coimmunoprecipitation 693718 N/A 693734 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 693725 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 2A slc14a2-snapap-9 Interaction between SLC14A2 and SNAPAP identified by coimmunoprecipitation 693719 N/A 693724 unspecified role unspecified role prey prey N/A 693725 unspecified role unspecified role bait bait physical association physical association false false false Fig. 6B O95295 infection slc14a2-snapap-10 Interaction between SLC14A2 and SNAPAP identified by coimmunoprecipitation 693719 N/A 693724 unspecified role unspecified role bait bait N/A 693725 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig. 6A O95295 infection slc14a2-snapap-1 Interaction between SLC14A2 and SNAPAP identified by Y2H 693720 N/A 693734 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 693725 unspecified role unspecified role prey prey physical association physical association false false false slc14a2-snapap-2 Interaction between SLC14A2 and SNAPAP identified by Y2H 693721 N/A 693734 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 693725 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B slc14a2-snapap-5 Interaction between SLC14A2 and SNAPAP identified by pulldown 693722 N/A 693734 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 693725 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 2B slc14a2-snapap-11 Interaction between SLC14A2 and SNAPAP identified by colocalization 693723 N/A 693724 unspecified role unspecified role neutral component neutral component N/A 693725 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 7 O95295 transfection