IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lu-2007-3 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation lu-2007-2 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation lu-2007-4 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. rat-l6 Rattus norvegicus l6 Rat L6 myotube cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation lu-2007-5 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation lu-2007-6 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy predetermined predetermined participant predetermined Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Time after treatment with 1uM Phorbol 12-myristate 13-acetate (mins) Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation lu-2007-1 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lu G., Chen J., Espinoza LA., Garfield S., Toshiyuki S., Akiko H., Huppler A., Wang QJ. Synapse - Interactions of proteins with an established role in the presynapse. qjw1@pitt.edu Human peripheral blood leukocyte Cell. Signal. (0898-6568) 2007 Only protein-protein interactions imex curation vamp2_human Vesicle-associated membrane protein 2 Synaptobrevin-2 VAMP2 SYB2 protein protein human Homo sapiens Human MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST g3hx91_crigr Serine/threonine-protein kinase I79_015610 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MSANNSPPSAQKSVLPATVSAVLPTPSPCSSPKTGLSARLSNGSCSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSENILQLITSADDIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEESHTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDSNDMNSDGSRGLDDSEEPSPPEDKMFFLDPTDLDVERDEETVKTISPSTSNNIPLMRVVQSIKHTKRRSSTMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRVSSPQDLSSISQGSNPHCFEIITDTVVYFVGENNGSSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASICTSPGQGKDHKDLATSISVSNSQVQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNLLQVKMRKRFSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLEYPKHFIMAPNPDDMEEDP kpcd3_human Serine/threonine-protein kinase D3 PRKD3 EPK2 PRKCN Protein kinase C nu type nPKC-nu Protein kinase EPK2 protein protein human Homo sapiens Human MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEESHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGMQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQGSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP d4a229_rat Serine/threonine-protein kinase Prkd3 protein protein rat Rattus norvegicus (Rat) Rat MSANNSPPSAQKSVFPATVSAVLPTPSPCSSPKTGLSARLSNGSFSAASLTNSRGSVHTVSFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHNMNSENILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHALYVHSYKAPTFCDYCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPECVPLLSEESHTHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYGRPTICQYCKRLLKGLFRQGLQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSVGTDTDMPMDIDSNDVNSDGSRGLDDSEEPSPPEDKMFFLDAADLDVERDEEPVKTISPSTSNNIPLMRVVQSIKHTKRKSSTVVKEGWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTSISQGSNPHCFEIITDTVVYFVGENNGNSTHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASVCTSPGQGKDHKDLATSISVSNCQIQENVDISSVYQIFADEVLGSGQFGIVYGGKHRKTGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDEDINDQIQNAAFMYPPNPWREISSEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLDLREFETRIGERYITHESDDARWEIHAYTHNLEYPKHFIMAPNPDDMEEGP vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST prkd3-vamp2-4 Interaction between PRKD3 and VAMP2 identified by coimmunoprecipitation 609067 N/A 609073 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 609074 unspecified role unspecified role prey prey direct interaction direct interaction false false false Fig. 4b prkd3-vamp2-5 Interaction between PRKD3 and VAMP2 identified by coimmunoprecipitation 609067 N/A 609075 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 609073 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 4b prkd3-vamp2-6 Interaction between PRKD3 and VAMP2 identified by coimmunoprecipitation 609067 N/A 609075 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 609073 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 4b prkd3-vamp2-2 Interaction between PRKD3 and VAMP2 identified by pulldown 609068 N/A 609075 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 609073 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig. 4A prkd3-vamp2-3 Interaction between PRKD3 and VAMP2 identified by pulldown 609068 N/A 609073 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 609075 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction false false false Fig. 4A prkd3-vamp2-7 Interaction between PRKD3 and VAMP2 identified by coimmunoprecipitation 609069 N/A 609076 unspecified role unspecified role prey prey N/A 609077 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4b prkd3-vamp2-8 Interaction between PRKD3 and VAMP2 identified by coimmunoprecipitation 609069 N/A 609076 unspecified role unspecified role bait bait N/A 609077 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4b Weak interaction - possibly due to limited VAMP2 expression prkd3-1 Autophosphorylation of PRKD3 609070 N/A 609075 putative self putative self putative self putative self region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O94806:p.[Ser731Ala;Ser735Glu] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false true false ser731ala_ser754glu mutant is constitutively active Fig. 5a prkd3-2 Autophosphorylation of PRKD3 609070 N/A 609075 putative self putative self putative self putative self phosphorylation phosphorylation reaction phosphorylation false true false Fig. 5a prkd3-vamp2-9 Interaction between PRKD3 and VAMP2 identified by colocalization 609071 N/A 609073 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 609075 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 6 0 prkd3-vamp2-10 Interaction between PRKD3 and VAMP2 identified by colocalization 609071 N/A 609073 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 609075 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 6 10 prkd3-vamp2-1 Interaction between PRKD3 and VAMP2 identified by Y2H 609072 N/A 609073 unspecified role unspecified role prey prey N/A 609075 unspecified role unspecified role bait bait physical association physical association false false false