IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ katagiri-2006-2 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis katagiri-2006-4 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. mouse-baf Mus musculus pro-B cells baf mouse pro-B cell line cannot establish identity to CABRI: ECACC 87033001 since furher info is missing. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. Analysis was carried out in cells expressing the constitutively active Rap1V12. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis katagiri-2006-1 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis katagiri-2006-3 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis katagiri-2006-5 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. mouse-lymphoblast Mus musculus lymphoblast Transformed lymphocytes; Blast cell; Lymphoblastoid fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. The authors have mentioned T cells as being the host cells. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis katagiri-2006-6 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion. mouse-lymphoblast Mus musculus lymphoblast Transformed lymphocytes; Blast cell; Lymphoblastoid solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Katagiri K., Imamura M., Kinashi T. Synapse - Interactions of proteins with an established role in the presynapse. The authors have mentioned lymphocytic cells as being the host cells. kinashi@takii.kmu.ac.jp human cDNA library Nat. Immunol. (1529-2908) 2006 Only protein-protein interactions imex curation Apoptosis - Interactions involving proteins with a function related to apoptosis q8www0-2 Ras association domain-containing protein 5 B RASSF5 NORE1 RAPL New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein human Homo sapiens Human MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG Initiator Met-1 is removed. Contains a N-acetylthreonine at position 2. stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF rasf5_mouse Ras association domain-containing protein 5 Rassf5 Nore1 Rapl New ras effector 1 Regulator for cell adhesion and polarization enriched in lymphoid tissues protein protein mouse Mus musculus Mouse MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALIPAAGASEDRGGRRSGRRDPEPTPRDCRHARPVRPGLQPRLRLRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCRQKGGPALDRRSPESTLTPTLNQNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADYPLYLRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG stk4_mouse Serine/threonine-protein kinase 4 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Stk4 Mst1 protein protein mouse Mus musculus Mouse METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDVKLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSGGANTMIEHGDTLPSQLGTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKNVSGSLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEMEEIRQKYRSKRQPILDAIEAKKRRQQNF stk3_human Serine/threonine-protein kinase 3 STE20-like kinase MST2 Mammalian STE20-like protein kinase 2 Serine/threonine-protein kinase Krs-1 STK3 MST2 KRS1 protein protein human Homo sapiens Human MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQNF itb2_mouse Integrin beta-2 Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta Complement receptor C3 subunit beta Itgb2 protein protein mouse Mus musculus Mouse MLGLRPSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES eea1_mouse Early endosome antigen 1 Eea1 protein protein mouse Mus musculus Mouse MFRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYQAVHDAGNDSGHGGEAGLALTRDDITLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKSDGLVTDSSAELQALEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEEKSLRAAAEQKVTHLTEDLNKQTTVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSEHAHLEATINQLRSELAKGPQEVAVYVQEIQKLKGSINELTQKNQNLTEKLQKKDLDYTHLEEKHNEESASRKTLQASLHQRDLDCQQLQARLTASESSLQRAQGELSEKAEAAQKLREELREVESTRQHLKVEVKQLQQQREEKEQHGLQLQGEVSQLHCKLLETERQLGEAHGRLKEQRQLSSEKLMEKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLEKSKQQHQEQQALQQSATAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKGKESVSLLEKEREDLYAKIQAGEGETAVLNQLQEKNHALQQQLTQLTEKLKNQSESHKQAEENLHDQVQEQKAHLRAAQDRVLSLETSVSELSSQLNESKEKVSQLDIQIKAKTELLLSAEAAKAAQRADLQNHLDTAQHALQDKQQELNKVSVQLDQLTAKFQEKQEHCIQLESHLKDHKEKHLSLEQKVEDLEGHIKKLEADALEVKASKEQALQSLQQQRQLSTDLELRNAELSRELQEQEEVVSCTKLDLQNKSEILENIKQTLTKKEEENVVLKQEFEKLSQDSKTQHKELGDRMQAAVTELTAVKAQKDALLAELSTTKEKLSKVSDSLKNSKSEFEKENQKGKAAVLDLEKACKELKHQLQVQAESALKEQEDLKKSLEKEKETSQQLKIELNSVKGEVSQAQNTLKQKEKDEQQLQGTINQLKQSAEQKKKQIEALQGEVKNAVSQKTVLENKLQQQSSQAAQELAAEKGKLSALQSNYEKCQADLKQLQSDLYGKESELLATRQDLKSVEEKLTLAQEDLISNRNQIGNQNKSIQELQAAKASLEQDSAKKEALLKEQSKALEDAQREKSVKEKELVAEKSKLAEMEEIKCRQEKEITKLNEELKSHKQESIKEITNLKDAKQLLIQQKLELQGRVDSLKAALEQEKESQQLMREQVKKEEEKRKEEFSEKEAKLHSEIKEKEAGMKKHEENEAKLTMQVTTLNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKALELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMSCGKCFSVTVRRHHCRQCGNIFCAECSTKNALTPSSKKPVRVCDACFNDLQG rassf5-mst1-1 506182 N/A 506188 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 506189 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1a rassf5-mst1-5 506182 N/A 506188 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 506189 unspecified role unspecified role bait bait c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1a rassf5-mst1-3 506183 N/A 506190 unspecified role unspecified role bait bait N/A 506191 unspecified role unspecified role prey prey physical association physical association false false false 1c Interaction was carried out in cells expressing the constitutively active Rap1V12. rassf5-mst1-4 506183 N/A 506190 unspecified role unspecified role prey prey N/A 506191 unspecified role unspecified role bait bait physical association physical association false false false 1c Interaction was carried out in the cells expressing the constitutively active Rap1V12. rassf5-mst1 506184 N/A 506188 unspecified role unspecified role bait bait Q8WWW0-2:p.[Lys123Ala;Arg124Ala;Lys135Ala;Lys154Ala;Lys155Ala;Asp160Ala;Asn161Ala] lys 123, 135, 154, 155; arg 124; asp 160; asn 161 replaced by ala mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 506189 unspecified role unspecified role prey prey physical association physical association false false false An activated form of RAPL (M4) was generated by the substitution by alanine of lysine positions 123, 135, 154 and 155, arginine at position 124, aspartic acid at position 160, and asparagine at position 161. rassf5-mst2 506184 N/A 506188 unspecified role unspecified role bait bait Q8WWW0-2:p.[Lys123Ala;Arg124Ala;Lys135Ala;Lys154Ala;Lys155Ala;Asp160Ala;Asn161Ala] lys 123, 135, 154, 155; arg 124; asp 160; asn 161 replaced by ala mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 506192 unspecified role unspecified role prey prey physical association physical association false false false RAPL (M4) was generated by the introduction of substitution by alanine of lysine residues at positions 123, 135, 154 and 155, of arginine at position 124, of aspartic acid at position 160, and of asparagine at position 161. rassf5-mst1-2 506185 N/A 506188 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false coiled coil region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 506189 unspecified role unspecified role prey prey c terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association false false false 1b rassf5-mst1-6 506186 N/A 506190 unspecified role unspecified role neutral component neutral component N/A 506191 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2e RAPL and Mst1 localized together in unstimulated T cells and also at the leading edge in CCL21-stimulated T cells mst1-rassf5 506187 N/A 506190 unspecified role unspecified role neutral component neutral component N/A 506193 unspecified role unspecified role neutral component neutral component N/A 506191 unspecified role unspecified role neutral component neutral component N/A 506194 unspecified role unspecified role neutral component neutral component physical association physical association false false false 7b Rab5, Rab11, and Rap1 also formed part of this complex however since the subspecies of protein involved could not be identified UniProtKB accession numbers could not be assigned. An complex was also observed between proteins TfR, Rap1 and beta2 integrin however, the UniProtKB accession numbers for TfR and Rap1 coudl not be determined since the subforms were not specified.