IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ chen-2006-2 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Directed yeast two hybrid assay. Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. chen-2006-5 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. chen-2006-1 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. chen-2006-3 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. chen-2006-4 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. chen-2006-6 GEC1 interacts with the kappa opioid receptor and enhances expression of the receptor. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen C., Li JG., Chen Y., Huang P., Wang Y., Liu-Chen LY. BioCreative - Critical Assessment of Information Extraction systems in Biology Figure 1 (A). lliuche@temple.edu Human brain cDNA library J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation Synapse - Interactions of proteins with an established role in the presynapse. oprk_human Kappa-type opioid receptor OPRK1 OPRK protein protein human Homo sapiens Human MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRVRNTVQDPAYLRDIDGMNKPV gbrl1_human Gamma-aminobutyric acid receptor-associated protein-like 1 GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1 Early estrogen-regulated protein GABARAPL1 GEC1 protein protein human Homo sapiens Human MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK oprk_rat Kappa-type opioid receptor Oprk1 Ror-d protein protein rat Rattus norvegicus (Rat) Rat MESPIQIFRGEPGPTCAPSACLLPNSSSWFPNWAESDSNGSVGSEDQQLEPAHISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSAVYLMNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLASSVGISAIVLGGTKVREDVDVIECSLQFPDDEYSWWDLFMKICVFVFAFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITKLVLVVVAVFIICWTPIHIFILVEALGSTSHSTAVLSSYYFCIALGYTNSSLNPVLYAFLDENFKRCFRDFCFPIKMRMERQSTNRVRNTVQDPASMRDVGGMNKPV gbrap_human Gamma-aminobutyric acid receptor-associated protein GABA(A) receptor-associated protein MM46 GABARAP FLC3B HT004 protein protein human Homo sapiens Human MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL nsf_crigr Vesicle-fusing ATPase NSF N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MAGRSMQAARCPTDELSLSNCAVVSEKDYQSGQHVIVRTSPNHKYIFTLRTHPSVVPGSVAFSLPQRKWAGLSIGQEIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD nsf_rat Vesicle-fusing ATPase Nsf Erg1 N-ethylmaleimide-sensitive fusion protein Vesicular-fusion protein NSF protein protein rat Rattus norvegicus (Rat) Rat MAGRTMQAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALMREEGASPLDFD gbrap_rat Gamma-aminobutyric acid receptor-associated protein Gabarap GABA(A) receptor-associated protein protein protein rat Rattus norvegicus (Rat) Rat MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL gec1-oprk1 Directed yeast 2 hybrid analysis reveals interaction between the OPRK1 protein and GEC1protein 364022 N/A 364028 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 364029 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false gec1-oprk1-1 Directed yeast 2 hybrid analysis reveals interaction between the OPRK1 protein and GEC1protein 364022 n/a 364029 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364030 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false gec1-oprk1-2 Directed yeast 2 hybrid analysis reveals interaction between the OPRK1 protein and GEC1protein 364022 N/A 364028 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364031 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false gec1-oprk1-3 GST pulldown analysis reveals interaction between the GEC1protein and OPRK1 protein 364023 N/A 364028 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 364029 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false gec1-nsf GST pulldown analysis reveals interaction between the GEC1protein and NSF protein 364023 N/A 364029 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 364032 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false oprk1-gec1 Yeast 2 hybrid analysis reveals interaction between the OPRK1 protein and GEC1protein 364024 n/a 364029 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 364028 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false oprk1-gec1-1 Coimmunoprecipitation analysis reveals interaction between the OPRK1 protein and GEC1protein 364025 N/A 364029 unspecified role unspecified role bait bait N/A 364028 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false oprk1-gec1-2 GST pulldown analysis reveals interaction between the OPRK1 protein and GEC1protein 364026 N/A 364029 unspecified role unspecified role prey prey n terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 364028 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false gec1-nsf-1 GST pulldown analysis reveals interaction between the GEC1protein and NSF protein 364027 N/A 364033 unspecified role unspecified role prey prey N/A 364034 unspecified role unspecified role bait bait physical association physical association false false false