IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ralser-2005-2 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis In some cases 3-AT was added to the growth medium to increase stringency of the assay due to autoactivation of reporter genes. A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-3 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-4 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-5 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-6 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-7 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. ralser-2005-1 Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ralser M., Nonhoff U., Albrecht M., Lengauer T., Wanker EE., Lehrach H., Krobitsch S. Apoptosis - Interactions involving proteins with a function related to apoptosis A mating appoach using 5760 prey clones was applied in this study. Verification of protein-protein interaction was confirmed through replicated matings. Figure 1 krobitsc@molgen.mpg.de Hum. Mol. Genet. (0964-6906) 2005 Huntington's - Publications describing interactions involved in Huntington's disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Synapse - Interactions of proteins with an established role in the presynapse. atx2_human Ataxin-2 Spinocerebellar ataxia type 2 protein Trinucleotide repeat-containing gene 13 protein SCA2 TNRC13 ATXN2 ATX2 protein protein human Homo sapiens Human MRSAAAAPRSPAVATESRRFAAARWPGWRSLQRPARRSGRGGGGAAPGPYPSAAPPPPGPGPPPSRQSSPPSASDCFGSNGNGGGAFRPGSRRLLGLGGPPRPFVVLLLPLASPGAPPAAPTRASPLGARASPPRSGVSLARPAPGCPRPACEPVYGPLTMSLKPQQQQQQQQQQQQQQQQQQQQQQQPPPAAANVRKPGGSGLLASPAAAPSPSSSSVSSSSATAPSSVVAATSGGGRPGLGRGRNSNKGLPQSTISFDGIYANMRMVHILTSVVGSKCEVQVKNGGIYEGVFKTYSPKCDLVLDAAHEKSTESSSGPKREEIMESILFKCSDFVVVQFKDMDSSYAKRDAFTDSAISAKVNGEHKEKDLEPWDAGELTANEELEALENDVSNGWDPNDMFRYNEENYGVVSTYDSSLSSYTVPLERDNSEEFLKREARANQLAEEIESSAQYKARVALENDDRSEEEKYTAVQRNSSEREGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSSPACKQEKDDKEEKKDAAEQVRKSTLNPNAKEFNPRSFSQPKPSTTPTSPRPQAQPSPSMVGHQQPTPVYTQPVCFAPNMMYPVPVSPGVQPLYPIPMTPMPVNQAKTYRAVPNMPQQRQDQHHQSAMMHPASAAGPPIAATPPAYSTQYVAYSPQQFPNQPLVQHVPHYQSQHPHVYSPVIQGNARMMAPPTHAQPGLVSSSATQYGAHEQTHAMYACPKLPYNKETSPSFYFAISTGSLAQQYAHPNATLHPHTPHPQPSATPTGQQQSQHGGSHPAPSPVQHHQHQAAQALHLASPQQQSAIYHAGLAPTPPSMTPASNTQSPQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL sh3g3_human Endophilin-A3 Endophilin-3 SH3 domain-containing GRB2-like protein 3 SH3 domain protein 2C EEN-B2 SH3GL3 CNSA3 SH3D2C protein protein human Homo sapiens Human MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ sh3g2_human Endophilin-A1 SH3GL2 CNSA2 SH3D2A Endophilin-1 SH3 domain-containing GRB2-like protein 2 SH3 domain protein 2A EEN-B1 protein protein human Homo sapiens Human MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH sh3g1_human Endophilin-A2 Endophilin-2 SH3 domain-containing GRB2-like protein 1 SH3 domain protein 2B Extra eleven-nineteen leukemia fusion gene protein EEN fusion partner of MLL SH3GL1 CNSA1 SH3D2B protein protein human Homo sapiens Human MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYVEVLVPLPQ 6E5BE978BC955077 hd_human Huntingtin HTT IT15 HD Huntington disease protein protein protein human Homo sapiens Human MATLEKLMKAFESLKSFQQQQQQQQQQQQQQQQQQQQQPPPPPPPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPPPGPAVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLPCLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAAGSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKDTSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPELLQTLTAVGGIGQLTAAKEESGGRSRSGSIVELIAGGGSSCSPVLSRKQKGKVLLGEEEALEDDSESRSDVSSSALTASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVSDILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLLRKTLKDESSVTCKLACTAVRNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTTC plsl_human Plastin-2 L-plastin Lymphocyte cytosolic protein 1 LC64P LCP1 PLS2 protein protein human Homo sapiens Human MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV plst_human Plastin-3 T-plastin PLS3 protein protein human Homo sapiens Human MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV atx2-cnsa3-1 Directed yeast 2 hybrid analysis reveals interaction between the ataxin-2 protein and endophilin-A3 protein 219412 N/A 219419 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 219420 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false It was demonstrated that increased length of the polyglutamine region did not affect interaction between ATX2 and SH3GL3 proteins as shown by LacZ activity assay. atx2-cnsa1 Directed yeast 2 hybrid analysis reveals interaction between the ataxin-2 protein and endophilin-A1 protein 219412 N/A 219421 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 219419 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false cnsa1-cnsa2 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A1 protein and endophilin-A2 protein 219412 N/A 219421 unspecified role unspecified role prey prey N/A 219422 unspecified role unspecified role bait bait physical association physical association false false false cnsa1-cnsa3 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A1 protein and endophilin-A3 protein 219412 N/A 219420 unspecified role unspecified role prey prey N/A 219421 unspecified role unspecified role bait bait physical association physical association false false false cnsa1-cnsa1 Directed yeast 2 hybrid analysis reveals homotypic interaction of the endophilin-A1 protein 219412 N/A 219421 unspecified role unspecified role bait bait N/A 219421 unspecified role unspecified role prey prey physical association physical association false false false cnsa2-cnsa2 Directed yeast 2 hybrid analysis reveals homotypic interaction of the endophilin-A2 protein 219412 N/A 219422 unspecified role unspecified role bait bait N/A 219422 unspecified role unspecified role prey prey physical association physical association false false false cnsa3-cnsa3 Directed yeast 2 hybrid analysis reveals homotypic interaction of the endophilin-A3 protein 219412 N/A 219420 unspecified role unspecified role prey prey N/A 219420 unspecified role unspecified role bait bait physical association physical association false false false cnsa2-cnsa3-1 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A2 protein and endophilin-A3 protein 219412 N/A 219422 unspecified role unspecified role bait bait N/A 219420 unspecified role unspecified role prey prey physical association physical association false false false cnsa2-cnsa1 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A2 protein and endophilin-A1 protein 219412 N/A 219421 unspecified role unspecified role bait bait N/A 219422 unspecified role unspecified role prey prey physical association physical association false false false cnsa3-cnsa1-1 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A3 protein and endophilin-A1 protein 219412 N/A 219420 unspecified role unspecified role bait bait N/A 219422 unspecified role unspecified role prey prey physical association physical association false false false cnsa3-cnsa2 Directed yeast 2 hybrid analysis reveals interaction between the endophilin-A3 protein and endophilin-A2 protein 219412 N/A 219421 unspecified role unspecified role prey prey N/A 219420 unspecified role unspecified role bait bait physical association physical association false false false cnas3-atx2 Directed yeast two hybrid analysis reveals competeive by ataxin-2 and huntingtin (exon 1) protein and endophillin-A3 219412 N/A 219423 inhibitor inhibitor ancillary ancillary region exon 1 region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 219419 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 219420 unspecified role unspecified role bait bait physical association physical association false false false ATX2 and huntingtin (exon 1 peptide sequence) compete for binding to endophilin-A3. atx2-cnsa1-1 Coimmunoprecipitation analysis reveals interaction between the ataxin-2 protein and endophilin-A1 protein 219413 N/A 219421 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 219419 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false atx2-cnsa3-2 Coimmunoprecipitation analysis reveals interaction between the ataxin-2 protein and endophilin--A3 protein 219413 N/A 219419 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 219420 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false cnsa1-cnsa1-1 Coimuunoprecipitation analysis reveals homotypic interaction of the endophilin-A1 protein 219413 N/A 219421 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219421 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cnsa1-cnsa3-1 Coimmunoprecipitation analysis reveals interaction between the endophilin-A1 protein and endophilin-A3 protein 219413 N/A 219420 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219421 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cnsa3-cnsa2-1 Coimmunoprecipitation analysis reveals interaction between the endophilin-A3 protein and endophilin-A2 protein 219413 N/A 219420 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219421 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false cnsa3-cnsa3-1 Coimmunoprecipitation analysis reveals homotypic interaction of the endophilin-A3 protein 219413 N/A 219420 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 219420 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false atx2-cnsa1-2 Coimmunoprecipitation analysis reveals interaction between the ataxin-2 protein and endophilin-A1 protein 219414 N/A 219419 unspecified role unspecified role prey prey n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 219421 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association false false false Authors note that a small amount of ataxin-2 protein (residues 117-126) was found in immunopreciptates of SH3GL2 but could be explained by heterodimer complexs of endophillin proteins with affinities for different regions of ataxin-2. atx2-cnsa3-3 Coimmunoprecipitation analysis reveals interaction between the ataxin-2 protein and endophilin--A3 protein 219414 N/A 219420 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 219419 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false lcp1-atx2 Coimmunoprecipitaion reveals interaction between L-Plastin and ataxin-2 219415 N/A 219424 unspecified role unspecified role bait bait N/A 219419 unspecified role unspecified role prey prey physical association physical association false false false This interaction was not detected using a directed yeast two hybrid assay. tcp1-atx2-1 Coimmunoprecipitaion reveals interaction between T-Plastin and ataxin-2 219415 N/A 219425 unspecified role unspecified role bait bait N/A 219419 unspecified role unspecified role prey prey physical association physical association false false false This interaction was not detected using a directed yeast two hybrid assay. tcp1-atx2-3 Colocalisation reveals interaction between T-Plastin and ataxin-2 219416 N/A 219419 unspecified role unspecified role neutral component neutral component N/A 219425 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. lcp1-atx2-2 Colocalisation reveals interaction between L-Plastin and ataxin-2 219416 N/A 219419 unspecified role unspecified role neutral component neutral component N/A 219424 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. tcp1-atx2-4 Colocalisation reveals interaction between T-Plastin and ataxin-2 219417 N/A 219419 unspecified role unspecified role neutral component neutral component N/A 219425 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. lcp1-atx2-3 Colocalisation reveals interaction between L-Plastin and ataxin-2 219417 N/A 219424 unspecified role unspecified role neutral component neutral component N/A 219419 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false The ATX2/T-plastin complex co-localised in the perinuclear area and cytoplasmic area of cells studied. atx2-cnsa3 Yeast 2 hybrid analysis reveals interaction between the ataxin-2 protein and endophilin--A3 protein 219418 N/A 219420 unspecified role unspecified role prey prey N/A 219419 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false