IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mattera-2003-5 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis interaction of fusion proteins was monitored by activation of HIS gene transcription plating on medium lacking histidine, leucine and tryptophane. The competitive inhibitot 3-AT was also added to prevent background growth. EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-1 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-4 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-6 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis the peptide bait is immobilized on streptavidin-agarose and tests for ability to bind proteins EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-2 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. in vitro In vitro immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis co-depletion. Lysate selectively depleted in bait is also depleted in protein preys. EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-3 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. mattera-2003-7 Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Mattera R., Arighi CN., Lodge R., Zerial M., Bonifacino JS. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Synapse - Interactions of proteins with an established role in the presynapse. gga1_human ADP-ribosylation factor-binding protein GGA1 Golgi-localized, gamma ear-containing, ARF-binding protein 1 Gamma-adaptin-related protein 1 GGA1 protein protein human Homo sapiens Human MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAGTTYPAMPTRPGEQASPEQPSASVSLLDDELMSLGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESIKPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL rabe1_human Rab GTPase-binding effector protein 1 Rabaptin-5 Rabaptin-5alpha Rabaptin-4 Renal carcinoma antigen NY-REN-17 RABEP1 RABPT5 RABPT5A RAB5EP protein protein human Homo sapiens Human MAQPGPASQPDVSLQQRVAELEKINAEFLRAQQQLEQEFNQKRAKFKELYLAKEEDLKRQNAVLQAAQDDLGHLRTQLWEAQAEMENIKAIATVSENTKQEAIDEVKRQWREEVASLQAVMKETVRDYEHQFHLRLEQERTQWAQYRESAEREIADLRRRLSEGQEEENLENEMKKAQEDAEKLRSVVMPMEKEIAALKDKLTEAEDKIKELEASKVKELNHYLEAEKSCRTDLEMYVAVLNTQKSVLQEDAEKLRKELHEVCHLLEQERQQHNQLKHTWQKANDQFLESQRLLMRDMQRMEIVLTSEQLRQVEELKKKDQEDDEQQRLNKRKDHKKADVEEEIKIPVVCALTQEESSAQLSNEEEHLDSTRGSVHSLDAGLLLPSGDPFSKSDNDMFKDGLRRAQSTDSLGTSGSLQSKALGYNYKAKSAGNLDESDFGPLVGADSVSENFDTASLGSLQMPSGFMLTKDQERAIKAMTPEQEETASLLSSVTQGMESAYVSPSGYRLVSETEWNLLQKEVHNAGNKLGRRCDMCSNYEKQLQGIQIQEAETRDQVKKLQLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQASEILLEELQQGLSQAKRDVQEQMAVLMQSREQVSEELVRLQKDNDSLQGKHSLHVSLQQAEDFILPDTTEALRELVLKYREDIINVRTAADHVEEKLKAEILFLKEQIQAEQCLKENLEETLQLEIENCKEEIASISSLKAELERIKVEKGQLESTLREKSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET gga2_human ADP-ribosylation factor-binding protein GGA2 Golgi-localized, gamma ear-containing, ARF-binding protein 2 Gamma-adaptin-related protein 2 VHS domain and ear domain of gamma-adaptin GGA2 KIAA1080 protein protein human Homo sapiens Human MAATAVAAAVAGTESAQGPPGPAASLELWLNKATDPSMSEQDWSAIQNFCEQVNTDPNGPTHAPWLLAHKIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPVTGMVSGQNCCEEKRNPSSSTLPGGGVQNPSADRNLLDLLSAQPAPCPLNYVSQKSVPKEVPPGTKSSPGWSWEAGPLAPSPSSQNTPLAQVFVPLESVKPSSLPPLIVYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTAPQPVWDIMFQVAVPKSMRVKLQPASSSKLPAFSPLMPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAVLGAA gga3_human ADP-ribosylation factor-binding protein GGA3 Golgi-localized, gamma ear-containing, ARF-binding protein 3 GGA3 KIAA0154 protein protein human Homo sapiens Human MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQVINGEVATLTLPDSEGNSQCSNQGTLIDLAELDTTNSLSSVLAPAPTPPSSGIPILPPPPQASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIVLQAAVPKSMKVKLQPPSGTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ ap1g2_human AP-1 complex subunit gamma-like 2 AP1G2 Gamma2-adaptin protein protein human Homo sapiens Human MVVPSLKLQDLIEEIRGAKTQAQEREVIQKECAHIRASFRDGDPVHRHRQLAKLLYVHMLGYPAHFGQMECLKLIASSRFTDKRVGYLGAMLLLDERHDAHLLITNSIKNDLSQGIQPVQGLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKVPELSSVFLPPCAQLLHERHHGILLGTITLITELCERSPAALRHFRKVVPQLVHILRTLVTMGYSTEHSISGVSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLFETVLTIMDIRSAAGLRVLAVNILGRFLLNSDRNIRYVALTSLLRLVQSDHSAVQRHRPTVVECLRETDASLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPTKRWHIDTILHVLTTAGTHVRDDAVANLTQLIGGAQELHAYSVRRLYNALAEDISQQPLVQVAAWCIGEYGDLLLAGNCEEIEPLQVDEEEVLALLEKVLQSHMSLPATRGYALTALMKLSTRLCGDNNRIRQVVSIYGSCLDVELQQRAVEYDTLFRKYDHMRAAILEKMPLVERDGPQADEEAKESKEAAQLSEAAPVPTEPQASQLLDLLDLLDGASGDVQHPPHLDPSPGGALVHLLDLPCVPPPPAPIPDLKVFEREGVQLNLSFIRPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ rabx5_bovin Rab5 GDP/GTP exchange factor Rabex-5 RABGEF1 RABEX5 protein protein bovin Bos taurus (Bovine) Bovine MSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGAKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEAMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKEVQDIVEKYPLEIRPPNQSVAAIDSENVENDKLPPPLQPQVYAG clh1_bovin Clathrin heavy chain 1 CLTC protein protein bovin Bos taurus (Bovine) Bovine MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPAYGQPQPGFGYSM gga1-rabep1-6 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA1 145950 N/A 145957 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA1 fragment used is GAT domain (148-314) Rabaptin-5 binding fragment used is 551-661 gga2-rabep1-3 yeast 2-Hybrid, prey = human rabaptin-5, bait= human GGA2 145950 N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145959 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA2 fragment used is GAT domain (164-330) Rabaptin-5 binding fragment used is 551-661 gga3-rabep1-2 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA3 145950 N/A 145960 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA3 fragment used is GAE domain (494-723) Rabaptin-5 binding fragment is 5-546 gga2-rabep1-2 yeast 2-Hybrid, prey= human rabaptin-5, bait = human GGA2 145950 N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145959 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA2 fragment used is GAE domain (489-723) Rabaptin-5 binding fragment used is 5-546 gga3-rabep1-3 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA3 145950 N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145960 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA3 fragment used is GAE domain (494-723) 428-455 rabaptin-5 fragment binds GGA3 GAE domain but with lower affinity than the full-length Rabaptin-5 binding fragment is 428-455 gga2-rabep1-4 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA2 145950 N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145959 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA2 fragment used is GAE domain (489-723) Rabaptin-5 fragment used is 428-455 Rabaptin-5 428-455 fragment binds GGA2 GAE domain but with lower affinity than the Rabaptin-5 full-length gga1-rabep1-7 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA1 145950 N/A 145958 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145957 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA1 fragment used is GAE domain (515-639) Rabaptin-5 binding fragment used is 5-476 motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. gga2-rabep1-5 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA2 145950 N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145959 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA2 fragment used is GAE domain (489-723) Rabaptin-5 fragment used is 5-476 motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. gga3-rabep1-4 yeast 2-Hybrid, prey = human rabaptin-5, bait = human GGA3 145950 N/A 145960 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false GGA3 fragment used is GAE domain (494-723) Rabaptin-5 binding fragment is 5-476 motif FGXLV of Rabaptin-5 (439-443) is important for binding as shown by alanine scanning. ap1g1-rabep1-1 yeast 2-Hybrid, prey = human rabaptin-5, bait = human adaptin gamma 1 145950 N/A 145961 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Rabaptin-5 binding fragment used is 5-476 F439, G440 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 1 ear domain is used (707-822) ap1g2-rabep1-1 yeast 2-Hybrid, prey = human rabaptin-5, bait = human adaptin gamma 2 145950 N/A 145962 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 145958 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Rabaptin-5 binding fragment used is 5-476 F439, G440 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 2 ear domain is used (670-785) rabgef1-ap1g2-1 GST pull-down, bait = human Adaptin gamma 2, prey = bovin rabex-5 145951 N/A 145963 unspecified role unspecified role prey prey N/A 145962 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false adaptin gamma 2 ear domain is used (670-785) adaptin gamma 2 ear is GST tagged rabgef1-gga1-1 GST pull-down, bait = human GGA1 GAE domain, prey = bovin rabex-5 145951 N/A 145963 unspecified role unspecified role prey prey N/A 145957 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false GGA1 GAE domain is used (515-639) GGA1 is GST tagged Amount of Rabex-5 bound to GGA1-GAE is decreased when the bovin brain lysat is depleted from Rabaptin-5 suggesting a tri-complex rabgef1-gga3-1 GST pull-down, bait = human GGA3 GAE domain, prey = bovin rabex-5 145951 N/A 145963 unspecified role unspecified role prey prey N/A 145960 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false the GGA3 fragment used is composed of GAE domain and part of the hinge domain (494-723) GGA3 is GST tagged rabgef1-gga2-1 GST pull-down, bait = human GGA2 GAE /hinge domains, prey = bovin rabex-5 145951 N/A 145963 unspecified role unspecified role prey prey N/A 145959 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false the GGA2 fragment used is composed of GAE domain and the hinge domain (331-613) GGA2 is GST tagged gga1-rabep1-5 co-immunoprecipitation, bait= human GGA1 , prey= human rabaptin-5 145952 N/A 145958 unspecified role unspecified role prey prey N/A 145957 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false GGA1 is GFP tagged gga2-rabep1-1 co-immunoprecipitation, bait= human GGA2 , prey= human rabaptin-5 145952 N/A 145958 unspecified role unspecified role prey prey N/A 145959 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false GGA2 is GFP tagged gga3-rabep1-1 co-immunoprecipitation, bait= human GGA3 , prey= human rabaptin-5 145952 N/A 145958 unspecified role unspecified role prey prey N/A 145960 unspecified role unspecified role bait bait human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false GGA3 is GFP tagged ap1g1-rabep1-2 affinity chromatography, prey = human rabaptin-5 petide , bait = human adaptin gamma 1ear 145953 N/A 145958 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 145961 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Rabaptin-5 binding peptide corresponds to 435-447 F439, L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 1 ear domain is used (707-822) ap1g2-rabep1-2 affinity chromatography, prey = human rabaptin-5 peptide , bait = human adaptin gamma 2 ear 145953 N/A 145958 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) N/A 145962 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Rabaptin-5 peptide corresponds to 435-447 F439 and L442 of Rabaptin-5 are important for binding as shown by alanine scanning. adaptin gamma 2 ear domain is used (670-785) gga1-rabep1-8 affinity chromatography, prey = human rabaptin-5 peptide , bait = human GGA 1GAE domain 145953 N/A 145957 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 145958 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false Rabaptin-5 binding peptide corresponds to 435-447 F439, L442 of Rabaptin-5 are important for binding as shown by alanine scanning. GAE domain of GAA1 is used (515-639) rabgef1-gga1-2 co-depletion, bait = human GGA1 GAE domain, prey = bovin rabex-5 145954 N/A 145963 unspecified role unspecified role prey prey N/A 145957 unspecified role unspecified role bait bait gae domain gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false gga1-rabep1-4 co-immunoprecipitation, bait= endogenous human GGA1 , prey= human rabaptin-5 145955 N/A 145959 unspecified role unspecified role bait bait N/A 145958 unspecified role unspecified role prey prey physical association physical association false false false cltc-gga2-1 GST pull-down, bait = human GGA2 GAE /hinge domains, prey = bovin clathrin H chain 145956 N/A 145964 unspecified role unspecified role prey prey N/A 145959 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false the GGA2 fragment used is composed of GAE domain and the hinge domain (331-613) GGA2 is GST tagged Rabaptin-5 (5-546 fragment) competes with this GGA2/clathrin interaction