UniProt UniProt http://www.uniprot.org carr-2015-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Carré A., Louzada RA., Fortunato RS., Ameziane-El-Hassani R., Morand S., Ogryzko V., de Carvalho DP., Grasberger H., Leto TL., Dupuy C. Rare diseases - Interactions investigated in the context of Rare genetic disease corinne.dupuy@gustaveroussy.fr Antioxidants & redox signaling 2015 Only protein-protein interactions imex curation imex curation carr-2015-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Carré A., Louzada RA., Fortunato RS., Ameziane-El-Hassani R., Morand S., Ogryzko V., de Carvalho DP., Grasberger H., Leto TL., Dupuy C. Rare diseases - Interactions investigated in the context of Rare genetic disease corinne.dupuy@gustaveroussy.fr Antioxidants & redox signaling 2015 Only protein-protein interactions imex curation imex curation carr-2015-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Carré A., Louzada RA., Fortunato RS., Ameziane-El-Hassani R., Morand S., Ogryzko V., de Carvalho DP., Grasberger H., Leto TL., Dupuy C. Rare diseases - Interactions investigated in the context of Rare genetic disease corinne.dupuy@gustaveroussy.fr Antioxidants & redox signaling 2015 Only protein-protein interactions imex curation imex curation carr-2015-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel western blot western blot Immuno blot Immuno blot Carré A., Louzada RA., Fortunato RS., Ameziane-El-Hassani R., Morand S., Ogryzko V., de Carvalho DP., Grasberger H., Leto TL., Dupuy C. Rare diseases - Interactions investigated in the context of Rare genetic disease corinne.dupuy@gustaveroussy.fr Antioxidants & redox signaling 2015 Only protein-protein interactions imex curation imex curation doxa2_human Dual oxidase maturation factor 2 DUOXA2 Dual oxidase activator 2 protein protein human Homo sapiens Human MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLSLFIGAEIVAVHFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQLNETIDYNEQFTWRLKENYAAEYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYASATLWVAFCFWLLSNVLLSTPAPLYGGLALLTTGAFALFGVFALASISSVPLCPLRLGSSALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRTLLDQSAKDCSQERGGSPLILGDPLHKQAALPDLKCITTNL duox2_human Dual oxidase 2 DUOX2 LNOX2 THOX2 Large NOX 2 Long NOX 2 NADH/NADPH thyroid oxidase p138-tox NADPH oxidase/peroxidase DUOX2 NADPH thyroid oxidase 2 Thyroid oxidase 2 p138 thyroid oxidase protein protein human Homo sapiens Human MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRRVPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVETPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLDGSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYEWLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKGFQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKFSRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLSQLELLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTLRDVLVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAITIIALCCLPLVSLLLSGVVAYFRGREHKKLQKKLKESVKKEAAKDGVPAMEWPGPKERSSPIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNNRGCRTLLLKIPKEYDLVLLFSSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVLDINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQLAEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNISCRVSFITRTPGERSHPQGLGPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQRGFLAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGIILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAILHSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLAIMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGDKLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSAPHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEENDHQDLVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF duoxa2-duox2-1 3710469 N/A 3710473 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3710474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9NRD8:p.Cys1162Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 4C duoxa2-duox2-2 3710469 N/A 3710473 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q1HG44:p.Cys233Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q1HG44:p.Cys167Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3710474 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 5D duox2-duoxa2-1 3710470 N/A 3710473 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3710474 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9NRD8:p.Cys124Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3A, Supp. Fig. 1B duox2-duoxa2-2 3710471 N/A 3710473 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3710474 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9NRD8:p.Cys124Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9NRD8:p.Cys351Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NRD8:p.Cys370Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q9NRD8:p.Cys568Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q9NRD8:p.Cys582Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3C duox2-duoxa2-3 3710472 N/A 3710473 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3710474 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9NRD8:p.Cys124Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 3B