IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hayama-2003-1 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Hayama A., Rai T., Sasaki S., Uchida S. Rare diseases - Interactions investigated in the context of Rare genetic disease suchida.kid@tmd.ac.jp Histochemistry and cell biology 2003 Only protein-protein interactions imex curation imex curation hayama-2003-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hayama A., Rai T., Sasaki S., Uchida S. Rare diseases - Interactions investigated in the context of Rare genetic disease suchida.kid@tmd.ac.jp Histochemistry and cell biology 2003 Only protein-protein interactions imex curation imex curation bsnd_human Barttin BSND BART protein protein human Homo sapiens Human MADEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGSVMVIGGIIWSMCQCYPKITFVPADSDFQGILSPKAMGLLENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRSLLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG mint Functions as a beta-subunit for CLCNKA and CLCNKB chloride channels. In the kidney CLCNK/BSND heteromers mediate chloride reabsorption by facilitating its basolateral efflux. In the stria, CLCNK/BSND channels drive potassium secretion by recycling chloride for the basolateral SLC12A2 cotransporter Defects in BSND are the cause of Bartter syndrome type 4 (BS4) [MIM:602522]; also known as infantile Bartter syndrome with sensorineural deafness. BS refers to a group of autosomal recessive disorders characterized by impaired salt reabsorption in the thick ascending loop of Henle with pronounced salt wasting, hypokalemic metabolic alkalosis, and varying degrees of hypercalciuria. BS4 is associated with sensorineural deafness q1w581_rat Chloride channel protein Clck2 protein protein rat Rattus norvegicus (Rat) Rat MEEIVGLREGSPRKPVPLQELWRPCPRIRRNIQGSLEWLKERLFRVGEDWYFLVALGVLMALISYAMNFAIGRVVRGSGIPEVKTILTGVILEDYLDIKNFGAKVVGLSCTLATGSTIFLGKLGPFVHLSVMIAAYLGRVRTKTVGEPENKTKEMELLAAGAAVGVATVFAAPISGVLFSIEVMSSHFSVWDYWRGFFAATCGAFMFHLLAVFNSEQETITSIYKTSFPVDIPFDLPEIFFFVALGAICGILSCGYNYCQRTSLFFLKSNGFTSKLLATSKPLYSALAAVVLASITYPPGVGRFMASRLSMSEYLETLFDNNSWALMTKNSSPPWSAEPDPQNLWLEWCHPQMTVFGTLVFFLVMKFWMLILATTIPIPAGYFLPIFVYGAAIGRLFGEVLSLAFPEGIVAGGKVSPIMPGAYALAGAAAFSGAVTHTLSTALLAFEVSGQIVHALPVLMAVLAANAICQSYQPSFYDGTIIVKKLPYLPWIRGRKIGSHLVTVGHFMNCTLTTLAKDMPLEEVIKVVISTDVTQYPLVETTESQVLVGIVKRTHLVQSLHTDSASWAPGQQPCLQDILANGCPTQPVTLQLSTETSLHETHNLFELLNLQLLFVTSRGRAVGSVSWVELKKAISTLTNPPAPK bsnd-clck2-1 3632297 N/A 3632299 unspecified role unspecified role neutral component neutral component expression modif expression level alteration expression modif fixed cell fixed cell Q8WZ55:p.Tyr98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q8WZ55:p.Arg8Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q8WZ55:p.Gly10Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3632300 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n- terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 5a-d bsnd-clck2-2 3632298 N/A 3632299 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q8WZ55:p.Gly10Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8WZ55:p.Tyr98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q8WZ55:p.Arg8Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3632300 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell n-terminal region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 6