IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brotherton-1998-1 Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Brotherton DH., Dhanaraj V., Wick S., Brizuela L., Domaille PJ., Volyanik E., Xu X., Parisini E., Smith BO., Archer SJ., Serrano M., Brenner SL., Blundell TL., Laue ED. PDBe - Data obtained from the Protein Data Bank Europe Nature (0028-0836) 1998 cdk6_human Cyclin-dependent kinase 6 CDK6 Serine/threonine-protein kinase PLSTIRE Cell division protein kinase 6 CDKN6 protein protein human Homo sapiens Human MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA cdn2d_mouse Cyclin-dependent kinase 4 inhibitor D Cdkn2d p19-INK4d protein protein mouse Mus musculus Mouse MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALELLKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHSSVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM cdk6-cdkn2d-3 P19ink4d/cdk6 complex 511586 N/A 511587 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm Stoichiometry: 1.0 N/A 511588 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 80.0%, free 74.700% 1.9A