IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ frazee-1998-1 The axial tyrosinate Fe3+ ligand in protocatechuate 3,4-dioxygenase influences substrate binding and product release: evidence for new reaction cycle intermediates. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Frazee RW., Orville AM., Dolbeare KB., Yu H., Ohlendorf DH., Lipscomb JD. PDBe - Data obtained from the Protein Data Bank Europe Biochemistry (0006-2960) 1998 pcxa_psepu Protocatechuate 3,4-dioxygenase alpha chain pcaG 3,4-PCD protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MPIELLPETPSQTAGPYVHIGLALEAAGNPTRDQEIWNRLAKPDAPGEHILLLGQVYDGNGHLVRDSFLEVWQADANGEYQDAYNLENAFNSFGRTATTFDAGEWTLHTVKPGVVNNAAGVPMAPHINISLFARGINIHLHTRLYFDDEAQANAKCPVLNLIEQPQRRETLIAKRCEVDGKTAYRFDIRIQGEGETVFFDF pcxb_psepu Protocatechuate 3,4-dioxygenase beta chain 3,4-PCD pcaH protein protein psepu Pseudomonas putida Arthrobacter siderocapsulatus MPAQDNSRFVIRDRNWHPKALTPDYKTSIARSPRQALVSIPQSISETTGPNFSHLGFGAHDHDLLLNFNNGGLPIGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGPNDWRPAHIHFGISGPSIATKLITQLYFEGDPLIPMCPIVKSIANPEAVQQLIAKLDMNNANPMDCLAYRFDIVLRGQRKTHFENC pcag-pcah-1 Protocatechuate 3,4-dioxygenase y447h mutant 511482 N/A 511483 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false psefl Pseudomonas fluorescens Stoichiometry: 6.0 N/A 511484 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false psefl Pseudomonas fluorescens Stoichiometry: 6.0 direct interaction direct interaction false false false 24meric, multimeric working 82.00% 2.1A