IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ radisky-2004-1 Binding, proteolytic, and crystallographic analyses of mutations at the protease-inhibitor interface of the subtilisin BPN'/chymotrypsin inhibitor 2 complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Radisky ES., Kwan G., Karen Lu CJ., Koshland DE. PDBe - Data obtained from the Protein Data Bank Europe Biochemistry (0006-2960) 2004 subt_bacam Subtilisin BPN' apr Subtilisin Novo Subtilisin DFE Alkaline protease protein protein bacam Bacillus amyloliquefaciens MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVISEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ q40059_horvu Ica-2 protein protein horvu Hordeum vulgare (Barley) Barley MSSMEKKPEGVNIGAGDRQNQKTEWPELVGKSVEEAKKVILQDKPAAQIIVLPVGTIVTMEYRIDRVRLFVDRLDNIAQVPRVG apr-ica_2-1 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 515166 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 84.900%, free 81.800% 1.7A apr-ica_2-2 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59k mutant 515166 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 83.400%, free 81.600% 1.57A apr-ica_2-3 Crystal structure of the complex of subtilsin bpn'with chymotrypsin inhibitor 2 m59g mutant 515166 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 84.200%, free 81.700% 1.7A apr-ica_2-4 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59a mutant 515166 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 83.900%, free 82.100% 1.45A apr-ica_2-5 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59y mutant 515166 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 84.500%, free 82.500% 1.59A apr-ica_2-6 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59f mutant 515166 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 85.100%, free 82.600% 1.67A apr-ica_2-7 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 y61a mutant 515166 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 84.500%, free 81.800% 1.68A apr-ica_2-8 Crystal structure of the complex of subtilisin bpn' with chymotrypsin inhibitor 2 m59k, in ph 9 cryosoak 515166 N/A 515167 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false bacsu Bacillus subtilis Stoichiometry: 1.0 N/A 515168 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 83.200%, free 81.700% 1.3A