IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ settembre-2004-1 Thiamin biosynthesis in Bacillus subtilis: structure of the thiazole synthase/sulfur carrier protein complex. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Settembre EC., Dorrestein PC., Zhai H., Chatterjee A., McLafferty FW., Begley TP., Ealick SE. PDBe - Data obtained from the Protein Data Bank Europe Biochemistry (0006-2960) 2004 thig_bacsu Thiazole synthase thiG BSU11690 yjbT protein protein bacsu Bacillus subtilis MSMLTIGGKSFQSRLLLGTGKYPSFDIQKEAVAVSESDILTFAVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKASGLCDMIKVEVIGCSRSLLPDPVETLKASEQLLEEGFIVLPYTSDDVVLARKLEELGVHAIMPGASPIGSGQGILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRLSYEAGRIPLKQYGTASSPGEGLPV this_bacsu Sulfur carrier protein ThiS thiS BSU11680 yjbS Thiamine biosynthesis protein ThiS protein protein bacsu Bacillus subtilis MLQLNGKDVKWKKDTGTIQDLLASYQLENKIVIVERNKEIIGKERYHEVELCDRDVIEIVHFVGGG thig-this-1 Structure of the thiazole synthase-this complex 515077 N/A 515078 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 515079 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false tetrameric, multimeric working 75.800%, free 69.500% 3.15A