IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ de_vos-2004-1 Crystal structure of T state aspartate carbamoyltransferase of the hyperthermophilic archaeon Sulfolobus acidocaldarius. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined De Vos D., Van Petegem F., Remaut H., Legrain C., Glansdorff N., Van Beeumen JJ. Archaea - Interaction dataset based on Archaea proteins J. Mol. Biol. (0022-2836) 2004 PDBe - Data obtained from the Protein Data Bank Europe pyri_sulac Aspartate carbamoyltransferase regulatory chain pyrI Saci_1595 protein protein sulac Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) MEIQGNRKELMVSKIKNGTVIDHIPAGRAFAVLNVLGIKGHEGFRIALVINVDSKKMGKKDIVKIEDKEISDTEANLITLIAPTATINIVREYEVVKKTKLEVPKVVKGILKCPNPYCITSNDVEAIPTFKTLTEKPLKMRCEYCETIIDENEIMSQILGANNK pyrb_sulac Aspartate carbamoyltransferase pyrB Saci_1596 Aspartate transcarbamylase protein protein sulac Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) MKHIISAYNFSRDELEDIFALTDKYSKNLNDTRKILSGKTISIAFFEPSTRTYLSFQKAIINLGGDVIGFSGEESTSVAKGENLADTIRMLNNYSDGIVMRHKYDGASRFASEISDIPVINAGDGKHEHPTQAVIDIYTINKHFNTIDGLVFALLGDLKYARTVNSLLRILTRFRPKLVYLISPQLLRARKEILDELNYPVKEVENPFEVINEVDVLYVTRIQKERFVDEMEYEKIKGSYIVSLDLANKMKKDSIILHPLPRVNEIDRKVDKTTKAKYFEQASYGVPVRMSILTKIYGE pyrb-pyri-9 Crystal structure of the unligated (t-state) aspartate transcarbamoylase from the extremely thermophilic archaeon sulfolobus acidocaldarius 514699 N/A 514700 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 514701 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dodecameric, multimeric working 80.700%, free 76.100% 2.6A