IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ o_neal-2004-1 Crystal structures of an intrinsically active cholera toxin mutant yield insight into the toxin activation mechanism. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined O'Neal CJ., Amaya EI., Jobling MG., Holmes RK., Hol WG. PDBe - Data obtained from the Protein Data Bank Europe Biochemistry (0006-2960) 2004 chta_vibch Cholera enterotoxin subunit A ctxA toxA VC_1457 Cholera enterotoxin, A chain protein protein vibch Vibrio cholerae MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL chtb_vibch Cholera enterotoxin subunit B ctxB toxB VC_1456 Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid protein protein vibch Vibrio cholerae MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN ctxa-ctxb-1 Cholera holotoxin with an a-subunit y30s mutation form 3 514510 N/A 514511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 514512 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 direct interaction direct interaction false false false hexameric, multimeric working 82.300%, free 77.600% 2.13A ctxa-ctxb-2 Cholera holotoxin with an a-subunit y30s mutation, crystal form 1 514510 N/A 514511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 514512 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 direct interaction direct interaction false false false hexameric, multimeric working 80.500%, free 73.800% 2.5A ctxa-ctxb-3 Cholera holotoxin with an a-subunit y30s mutation, crystal form 2 514510 N/A 514512 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 N/A 514511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false hexameric, multimeric working 83.900%, free 80.900% 1.75A ctxa-ctxb-4 Cholera holotoxin, crystal form 1 514510 N/A 514511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 514512 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 10.0 direct interaction direct interaction false false false hexameric, multimeric working 83.300%, free 79.500% 1.9A ctxa-ctxb-5 Cholera holotoxin, crystal form 2 514510 N/A 514512 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 N/A 514511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false hexameric, multimeric working 78.700%, free 74.00% 2.6A