MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bracher-2002-1 X-ray structure of a neuronal complexin-SNARE complex from squid. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bracher A., Kadlec J., Betz H., Weissenhorn W. PDBe - Data obtained from the Protein Data Bank Europe J. Biol. Chem. (0021-9258) 2002 syb_dorpe Synaptobrevin protein protein lolpe Loligo pealeii Loligo pallida MSGPQNPQAGPGGPPSGPPQPGGPPGPPQGPPQPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFWWKNCKMMIILGGIVAVIVTVIIVWAAT q8t3s4_dorpe Synaptosomal-associated protein protein protein lolpe Loligo pealeii Loligo pallida MSANGEVEVPKTELEEIQQQCNQVTDDSLESTRRMLNMCEESKEAGIRTLVMLDEQGEQLDRIEEGLDQINQDMKDAEKNLEGMEKCCGLCVLPWKRGKSFEKSGDYANTWKKDDDGPTNTNGPRVTVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKLLKN o46345_dorpe protein protein lolpe Loligo pealeii Loligo pallida MTKDRLAALKAAVSDEEDVEEVAVQVDSGGGFMEEFFEQVEEIRAMIDKISDNVDAVKKKHSDILSAPQTDDQMKEELEELMTDIKRTANKVRGKLKTIELNIEQEEHSNKSSADLRIRKTQYSTISRKFVEVMSDYNTTQIDYRDRCKARIKRQMEITGRTTTNEELEDMLESGNPAIFTQGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKAVKYQSKARQKKIAILVCLVILVLVIVSTVGGVFGG cplx_dorpe Complexin cpx Synaphin protein protein lolpe Loligo pealeii Loligo pallida MAAFIAKQMVGDQLKSVKAMGGDEGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEGRVGRKKKTKEELAAEANEEEDDDEFAKFPTDLSDLTTKVSELPQKMAASVGEVTEKCSLQ cpx-o46345-1 X-ray structure of the neuronal complexin-snare complex from the squid loligo pealei 99851 N/A 99852 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99853 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99854 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99855 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99853 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false pentameric, multimeric working 70.300%, free 65.500% 2.95A