MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint vandemark-2001-1 Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined VanDemark AP., Hofmann RM., Tsui C., Pickart CM., Wolberger C. PDBe - Data obtained from the Protein Data Bank Europe Cell (0092-8674) 2001 mms2_yeast Ubiquitin-conjugating enzyme variant MMS2 MMS2 YGL087C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVPRNFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF E1DA713C94378795 ubc13_yeast Ubiquitin-conjugating enzyme E2 13 UBC13 YDR092W YD6652.04 Ubiquitin-protein ligase 13 Ubiquitin carrier protein 13 E2 ubiquitin-conjugating enzyme 13 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEQGAKAKAREWTKLYAKKKPE 445558F8F193275B mms2-ubc13-1 Mms2-ubc13 ubiquitin conjugating enzyme complex 99707 N/A 99708 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 99709 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 direct interaction direct interaction false false false dimeric, multimeric working 79.700%, free 76.100% 1.6A