IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fournier-2002-1 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fournier HN., Dupe-Manet S., Bouvard D., Lacombe ML., Marie C., Block MR., Albiges-Rizo C. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. block@ujf-grenoble.fr Human placenta MATCHMAKER cDNA J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation fournier-2002-2 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Fournier HN., Dupe-Manet S., Bouvard D., Lacombe ML., Marie C., Block MR., Albiges-Rizo C. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. block@ujf-grenoble.fr Human placenta MATCHMAKER cDNA J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation fournier-2002-3 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fournier HN., Dupe-Manet S., Bouvard D., Lacombe ML., Marie C., Block MR., Albiges-Rizo C. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. block@ujf-grenoble.fr Human placenta MATCHMAKER cDNA J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation fournier-2002-4 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fournier HN., Dupe-Manet S., Bouvard D., Lacombe ML., Marie C., Block MR., Albiges-Rizo C. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. block@ujf-grenoble.fr Human placenta MATCHMAKER cDNA J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation fournier-2002-5 Integrin cytoplasmic domain-associated protein 1alpha (ICAP-1alpha ) interacts directly with the metastasis suppressor nm23-H2, and both proteins are targeted to newly formed cell adhesion sites upon integrin engagement. human-hs68 Homo sapiens Hs68 normal diploid foreskin fibroblasts hs68 Human Hs68 normal diploid foreskin fibroblasts confocal microscopy confocal microscopy immunostaining immunostaining Fournier HN., Dupe-Manet S., Bouvard D., Lacombe ML., Marie C., Block MR., Albiges-Rizo C. NDPK - Interactions involving proteins containing InterPro domain IPR001564, Nucleoside diphosphate kinase, core. block@ujf-grenoble.fr Human placenta MATCHMAKER cDNA J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation ndkb_human Nucleoside diphosphate kinase B nm23-H2 C-myc purine-binding transcription factor PUF NME2 NM23B Histidine protein kinase NDKB protein protein human Homo sapiens Human MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE o14713-1 Integrin beta-1-binding protein 1 ITGB1BP1 ICAP1 Integrin cytoplasmic domain-associated protein 1 ICAP1-alpha protein protein human Homo sapiens Human MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK itgb1bp1-nme2-1 Interaction between ITGB1BP1 and NME2 identified by Y2H 782759 n/a 782764 unspecified role unspecified role prey prey n/a 782765 unspecified role unspecified role bait bait physical association physical association false false false itgb1bp1-itgb1-1 Interaction between ITGB1BP1 and ITGB1identified by Y2H 782759 n/a 782765 unspecified role unspecified role bait bait n/a 782766 unspecified role unspecified role prey prey physical association physical association false false false itgb1bp1-nme2-2 Interaction between ITGB1BP1 and NME2 identified by ELISA 782760 n/a 782764 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 782765 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A itgb1bp1-nme2-3 Interaction between ITGB1BP1 and NME2 identified by ELISA 782760 n/a 782765 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 782764 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2A itgb1bp1-nme2-4 Interaction between ITGB1BP1 and NME2 identified by pulldown 782761 n/a 782765 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 782764 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2B Both monomeric and dimeric ITGB1BP1 bound to NME2 itgb1bp1-nme2-5 Interaction between ITGB1BP1 and NME2 identified by pulldown 782761 n/a 782764 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 Stoichiometry: 2.0 n/a 782765 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2B Only the dimeric form of NME2 was bound to ITGB1BP1 itgb1bp1-nme2-6 Interaction between ITGB1BP1 and NME2 identified by coimmunoprecipitation 782762 n/a 782765 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 782764 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2D O14713-1 transfection itgb1bp1-nme2-7 Colocalisation of ITGB1BP1 and NME2 782763 n/a 782764 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 782765 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) colocalization colocalization false false false Fig. 3