IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ moriuchi-1997-1 Nuclear factor-kappa B potently up-regulates the promoter activity of RANTES, a chemokine that blocks HIV infection. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Moriuchi H., Moriuchi M., Fauci A.S. IBD - Inflammatory bowel disease The mutated sequence of the putative NFAT element DNA probe does not correspond to the wild type sequence (i.e. there is an additional base in the mutated sequence, or one is lacking in the wild type sequence) (Table 1), hence the exact positions of the base changes could not be derived. DNA probes corresponding to the NF-kB consensus sequence from the Ig k-chain enhancer region, the NFAT consensus sequence from the IL-2 promoter region, and the CD28 response element from the IL-2 promoter were also used as competitors in this experiment; however, the sequences of these probe could not be established, hence interactions involving these participants are not captured here. Nuclear extracts were prepared from cells stimulated with phorbol 13-acetate 12-myristate (PMA) (CHEBI:37537) and ionomycin (CHEBI:63954). hmoriuchi@atlas.niaid.nih.gov J. Immunol. (0022-1767) 1997 imex curation Only protein-protein interactions imex curation tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS ccl5-derived_putative-nfkb-site1_dna-probe Human CCL5 gene promoter derived putative consensus NF-kappaB-binding site 1 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) ATTTTGGAAACTCCCTTAGG ccl5-derived_putative-nfkb-site2_dna-probe Human CCL5 gene promoter derived putative consensus NF-kappaB-binding site 2 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TTGAGGGGATGCCCCTAAGG p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 nfac2_human Nuclear factor of activated T-cells, cytoplasmic 2 T-cell transcription factor NFAT1 NFAT pre-existing subunit NFATC2 NFAT1 NFATP protein protein human Homo sapiens Human MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPARNQT ccl5-derived_putative-nfat-site_dna-probe Human CCL5 gene promoter derived putative consensus NFAT-binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) ccl5_human_cd28re_dna-probe Human CCL5 gene promoter CD28 response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AAAGCAAGAAATTCCCACAA rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV ccl5_derived-rela-2 1765389 n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765391 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 7b ccl5_derived-ccl5_derived-6 1765389 n/a 1765391 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765391 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association false false false Fig. 7a ccl5_derived-ccl5_derived-1 1765389 n/a 1765391 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765392 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 7a ccl5_derived-nfkb1-2 1765389 n/a 1765391 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association false false false Fig. 7b ccl5_derived-ccl5_derived-2 1765389 n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765391 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765391 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 7a ccl5_derived-nfatc2-1 1765389 n/a 1765394 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 8b ccl5_derived-nfkb1-1 1765389 n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 8c ccl5_derived-rela-1 1765389 n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association false false false Fig. 8c ccl5_derived-ccl5_derived-3 1765389 n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765395 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 8a ccl5_derived-ccl5_derived-4 1765389 n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765395 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 8a ccl5_derived-ccl5_derived-5 1765389 n/a 1765395 competitor competitor competitor prey prey region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765395 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765394 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association false false false Fig. 8a ccl5-rela-1 1765389 n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies Q04206 increases expression at RNA level of ENSG00000271503 ccl5-nfkb1-1 1765389 n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association false false false Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies ccl5-rel-2 1765389 n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765397 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells physical association physical association false false false Fig. 9b, 10b, 10c treatment with anti-CD3 and anti-CD28 antibodies Q04864 increases expression at RNA level of ENSG00000271503 ccl5-ccl5-6 1765389 n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a ccl5-ccl5-1 1765389 n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765396 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association false false false Fig. 9a ccl5-ccl5-2 1765389 n/a 1765397 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 competitor competitor competitor prey prey g8c_a10t_t13g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a ccl5-ccl5_derived-6 1765389 n/a 1765397 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765391 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a ccl5-ccl5_derived-1 1765389 n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765391 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association false false false Fig. 9a ccl5-ccl5_derived-2 1765389 n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765391 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a ccl5-ccl5_derived-3 1765389 n/a 1765392 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765390 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a ccl5-ccl5_derived-4 1765389 n/a 1765392 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765393 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells association association false false false Fig. 9a ccl5-ccl5_derived-5 1765389 n/a 1765396 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1765397 unspecified role unspecified role prey prey human-hvs_cd8+ Homo sapiens CD8+ T cells infrected with herpesvirus saimiri (HVS) hvs_cd8+ herpesvirus saimiri (HVS) infected CD8+ T cells n/a 1765392 competitor competitor competitor prey prey chemical synthesis Chemical synthesis (Chemical synthesis) association association false false false Fig. 9a