IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sarmento-2015-1 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Interactions with H3K9me3/me2 have not been included due to antibody non-specificity. naive CD4+ T cells faubion.william@mayo.edu Cellular and molecular gastroenterology and hepatology 2015 imex curation Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA., Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. IBD - Inflammatory bowel disease The origins of His-KLF14 in figure 8 are not given and the authors did not reply to a request for information. However this construct has been assumed to be of Murine origin. Only protein-protein interactions imex curation sarmento-2015-2 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. Diabetes - Interactions investigated in the context of Diabetes Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Interactions with H3K9me3 have not been included due to antibody non-specificity. Regulatory T cells (CD4+) CD25+ faubion.william@mayo.edu Cellular and molecular gastroenterology and hepatology 2015 imex curation Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA., Sarmento OF., Svingen PA., Xiong Y., Xavier RJ., McGovern D., Smyrk TC., Papadakis KA., Urrutia RA., Faubion WA. IBD - Inflammatory bowel disease The origins of His-KLF14 in figure 8 are not given and the authors did not reply to a request for information. However this construct has been assumed to be of Murine origin. Only protein-protein interactions imex curation foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse klf14_mouse Krueppel-like factor 14 Klf14 protein protein mouse Mus musculus Mouse MSAAVACLDYFAAECLVSMSTRAVLHRRATDPEGASAAAVSEVGAVSRESAGKGTGSRGVLWIPPVLQVPTPSPGEGDGAPHLLAASALADLSCGAREDFREDSEEAPCASTSCFEPTWCSSPTGGSEPTQAFFEDELSDAESSCSDSAILDAPEASEEPDDSGEVPEGPPGARPAPSTGPTYRRRQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRPEPPPPAMVESSGSDSSSSSGQETSFTACL suv91_mouse Histone-lysine N-methyltransferase SUV39H1 Suv39h1 Suv39h Suppressor of variegation 3-9 homolog 1 Position-effect variegation 3-9 homolog Histone H3-K9 methyltransferase 1 protein protein mouse Mus musculus Mouse MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSENTWEPRQNLKCIRVLKQFHKDLERELVRRHRRSKPPRHLDPNLANYLVQKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAVGCECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQKGIRYDLCIFRTNDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF cbx3_mouse Chromobox protein homolog 3 Cbx3 Heterochromatin protein 1 homolog gamma Modifier 2 protein M32 protein protein mouse Mus musculus Mouse MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEDFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ cbx1_mouse Chromobox protein homolog 1 Cbx1 Cbx Heterochromatin protein 1 homolog beta Modifier 1 protein M31 Heterochromatin protein p25 protein protein mouse Mus musculus Mouse MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN klf14-foxp3-1 1852890 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852893 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 8 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 decreases expression at RNA level of ENSMUSG00000039521 Q19A41 decreases expression at protein level of ENSMUSG00000039521 suv39h1-foxp3-1 1852890 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852894 unspecified role unspecified role bait bait association association false false false 9i The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of O54864 to ENSMUSG00000039521 Q19A41 increases binding of O54864 to ENSMUSG00000039521 cbx3-foxp3-1 1852890 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852895 unspecified role unspecified role bait bait association association false false false 9ii The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of P23198 to ENSMUSG00000039521 Q19A41 increases binding of P23198 to ENSMUSG00000039521 cbx3-foxp3-2 1852890 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852896 unspecified role unspecified role bait bait association association false false false 9iii The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. P01137 increases binding of P83917 to ENSMUSG00000039521 Q19A41 increases binding of P83917 to ENSMUSG00000039521 suv39h1-foxp3-2 1852891 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852894 unspecified role unspecified role bait bait association association false false false Fig. 11 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 increases binding of O54864 to ENSMUSG00000039521 cbx3-foxp3-3 1852891 N/A 1852892 unspecified role unspecified role prey prey tsdr(Treg-specific demethylation region) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852895 unspecified role unspecified role bait bait association association false false false Fig. 11 The Treg-specific demethylated region (TSDR) is a CpG-rich, noncoding sequence within the first intron of the Foxp3 gene locus. Q19A41 increases binding of O54864 to ENSMUSG00000039521