IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ liu-2014e-1 A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease HepG2 cells were treated with 12-O-tetradecanoylphorbol-13-acetate (TPA) (CHEBI:37537) (40 ng/ml) for 4 hours before cross-linking with formaldehyde. lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn Nucleic Acids Res. (0305-1048) 2014 Only protein-protein interactions imex curation liu-2014e-2 A novel AP-1/miR-101 regulatory feedback loop and its implication in the migration and invasion of hepatoma cells. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Liu J.J., Lin X.J., Yang X.J., Zhou L., He S., Zhuang S.M., Yang J. IBD - Inflammatory bowel disease Nuclear extracts were prepared from HepG2 cells treated with 12-O-tetradecanoylphorbol-13-acetate (TPA) (CHEBI:37537). lssyje@mail.sysu.edu.cn,zhuangshimei@163.com,lsszsm@mail.sysu.edu.cn Nucleic Acids Res. (0305-1048) 2014 Only protein-protein interactions imex curation mir-101-2_human_gene microRNA-101-2 (miR-101-2) human gene gene gene human Homo sapiens Human jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL mmp1_human_gene Interstitial collagenase (MMP1) human gene gene gene human Homo sapiens Human mir-101-2_human_ap1-site-a_dna-probe Human microRNA-101-2 gene promoter canonical AP1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TCCCACTGACTCATTGGAAGAGCTGTGTGACTCAGTGTAT mir-101-2_human_ap1-site-b_dna-probe Human microRNA-101-2 gene promoter non-canonical AP1 binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TGTATGTGTGTCACATTTGAAGTCACCAGTT jun-mir_101_2-1 1767138 n/a 1767140 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767141 unspecified role unspecified role bait bait association association false false false Fig. 3a, 3b anti-c-Jun siRNA P05412 increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of P05412 CHEBI:37537 indirectly increases expression at protein level of P05412 fos-mir_101_2-1 1767138 n/a 1767140 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767142 unspecified role unspecified role bait bait association association false false false Fig. 3a, 3b anti-c-Fos siRNA P01100 increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of ENSG00000199065 CHEBI:37537 indirectly increases expression at RNA level of P01100 CHEBI:37537 indirectly increases expression at protein level of P01100 jun-mmp1-1 1767138 n/a 1767143 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767141 unspecified role unspecified role bait bait association association false false false Fig. 3a, 3b anti-c-Jun siRNA fos-mmp1-1 1767138 n/a 1767143 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767142 unspecified role unspecified role bait bait association association false false false Fig. 3a, 3b anti-c-Fos siRNA CHEBI:37537 indirectly increases expression at RNA level of ENSG00000196611 mir_101_2-fos-1 1767139 n/a 1767144 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1767142 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association false false false Fig. 3d mir_101_2-jun-1 1767139 n/a 1767144 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1767141 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). physical association physical association false false false Fig. 3d mir_101_2-jun-2 1767139 n/a 1767141 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). n/a 1767145 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 3d mir_101_2-fos-2 1767139 n/a 1767142 unspecified role unspecified role prey prey human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). n/a 1767145 unspecified role unspecified role bait bait 3-prime biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 3d