IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2014e-2 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease This experiment is described in more detail in PMID:16472676. wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation wang-2014e-3 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation wang-2014e-1 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation wang-2014e-5 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation wang-2014e-6 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation wang-2014e-7 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance. in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Wang M., Guo L., Wu Q., Zeng T., Lin Q., Qiao Y., Wang Q., Liu M., Zhang X., Ren L., Zhang S., Pei Y., Yin Z., Ding F., Wang H.R. IBD - Inflammatory bowel disease wanghr@xmu.edu.cn Nat Commun 2014 Only protein-protein interactions imex curation q9hce7-2 E3 ubiquitin-protein ligase SMURF1 HECT-type E3 ubiquitin transferase SMURF1 SMURF1 KIAA1625 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE rhob_human Rho-related GTP-binding protein RhoB Rho cDNA clone 6 RHOB ARH6 ARHB protein protein human Homo sapiens Human MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL chk1_human Serine/threonine-protein kinase Chk1 CHEK1 CHK1 CHK1 checkpoint homolog Checkpoint kinase-1 Cell cycle checkpoint kinase protein protein human Homo sapiens Human MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT smuf1_human E3 ubiquitin-protein ligase SMURF1 SMAD ubiquitination regulatory factor 1 SMAD-specific E3 ubiquitin-protein ligase 1 SMURF1 KIAA1625 HECT-type E3 ubiquitin transferase SMURF1 protein protein human Homo sapiens Human MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE smurf1-rhob 1572441 n/a 1572447 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c2_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false hect sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1572448 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 1e, 2a, Suppl. Fig. 17 Q9HCE7-2 increases degradation at protein level of P62745 Q9HCE7-2 is required for ubiquitination of P62745 smurf1-chek1-2 1572441 n/a 1572447 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1572449 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 8d, Suppl. Fig. 18 O14757 is required for phosphorylation of Q9HCE7-2 O14757 decreases quantity of Q9HCE7-2 smurf1-rhob-1 1572442 n/a 1572448 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572447 unspecified role unspecified role bait bait c2_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false catalytically inactive mutant hect sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2a, 2b, Suppl. Fig. 1c, 17, 18 smurf1-chek1-1 1572442 n/a 1572449 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572447 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 8c, Suppl. Fig. 18 rhob-smurf1 1572443 n/a 1572448 unspecified role unspecified role bait bait n/a 1572447 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9HCE7-2:p.Cys699Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false catalytically inactive mutant physical association physical association false false false Fig. 1d, Suppl. Fig. 17 chek1-smurf1 1572444 n/a 1572449 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1572450 unspecified role unspecified role prey prey physical association physical association false false false Fig. 8a, Suppl. Fig. 18 smurf1-chek1 1572445 n/a 1572447 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9HCE7-2:p.Cys699Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false catalytically inactive mutant n/a 1572449 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 8b, Suppl. Fig. 13b, 18 ultraviolet (80 Jm-2) methyl methanesulfonate (MMS) (CHEBI:25255) (0.5 mM) chek1-smurf1-1 1572446 n/a 1572447 enzyme target enzyme target substrate substrate neutral component neutral component n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9HCE7-2:p.[Thr145Ala;Thr161Ala;Thr682Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false escherichia coli dh5[alpha] escherichia coli dh5[alpha] n/a 1572449 enzyme enzyme neutral component neutral component O14757:p.Asp130Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 phosphorylation phosphorylation reaction phosphorylation false false false Fig. 8e, 8f, Suppl. Fig. 14, 15, 18 Inconsistency between figure legend and methods section. Figure legend (8, suppl. 14) says HA-tagged Chk1 was immunoprecipitated from MMS-treated HeLa cells, while methods section says Flag-tagged Chk1 was immunoprecipitated from MMS-treated HEK293T cells. For this entry, annotation in the figure legends was followed. Q9HCE7-2 thr-145 O-phospho-L-threonine Q9HCE7-2 thr-161 O-phospho-L-threonine Q9HCE7-2 thr-682 O-phospho-L-threonine