IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wu-2014-7 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wu C., Thalhamer T., Franca RF., Xiao S., Wang C., Hotta C., Zhu C., Hirashima M., Anderson AC., Kuchroo VK. IBD - Inflammatory bowel disease WT, and Cd44–/– or or Lgals9–/– iTreg cells. The authors have stated that TGF-beta is of human origin. vkuchroo@rics.bwh.harvard.edu Immunity 2014 Only protein-protein interactions imex curation imex curation wu-2014-5 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Wu C., Thalhamer T., Franca RF., Xiao S., Wang C., Hotta C., Zhu C., Hirashima M., Anderson AC., Kuchroo VK. IBD - Inflammatory bowel disease Naive, Th0 (precursor) or Induced TReg cells:(Naïve -CD44loCD62L+CD25– CD4+ T cells). Cells were stimulated with plate-bound anti-CD3, anti-CD28 and appropriate cytokines. The authors have stated that TGF-beta is of human origin. vkuchroo@rics.bwh.harvard.edu Immunity 2014 Only protein-protein interactions imex curation imex curation wu-2014-6 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Wu C., Thalhamer T., Franca RF., Xiao S., Wang C., Hotta C., Zhu C., Hirashima M., Anderson AC., Kuchroo VK. IBD - Inflammatory bowel disease Th0 (precursor) and iTreg cells from WT or Lgals9–/– mice. Cells were stimulated with anti-CD3 and anti-CD28, in the presence or absence of TGF-beta. The authors have stated that TGF-beta is of human origin. vkuchroo@rics.bwh.harvard.edu Immunity 2014 Only protein-protein interactions imex curation imex curation wu-2014-8 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Wu C., Thalhamer T., Franca RF., Xiao S., Wang C., Hotta C., Zhu C., Hirashima M., Anderson AC., Kuchroo VK. IBD - Inflammatory bowel disease iTreg cells from WT or Lgals9–/– mice. The authors have stated that TGF-beta is of human origin. vkuchroo@rics.bwh.harvard.edu Immunity 2014 Only protein-protein interactions imex curation imex curation cd44_mouse CD44 antigen Phagocytic glycoprotein I Cd44 Ly-24 Phagocytic glycoprotein 1 HUTCH-I Extracellular matrix receptor III GP90 lymphocyte homing/adhesion receptor Hermes antigen Hyaluronate receptor Lymphocyte antigen 24 protein protein mouse Mus musculus Mouse MDKFWWHTAWGLCLLQLSLAHQQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPEGYILHTYLPTEQPTGDQDDSFFIRSTLATIASTVHSKSHAAAQKQNNWIWSWFGNSQSTTQTQEPTTSATTALMTTPETPPKRQEAQNWFSWLFQPSESKSHLHTTTKMPGTESNTNPTGWEPNEENEDETDTYPSFSGSGIDDDEDFISSTIATTPRVSARTEDNQDWTQWKPNHSNPEVLLQTTTRMADIDRISTSAHGENWTPEPQPPFNNHEYQDEEETPHATSTTPNSTAEAAATQQETWFQNGWQGKNPPTPSEDSHVTEGTTASAHNNHPSQRITTQSQEDVSWTDFFDPISHPMGQGHQTESKDTDSSHSTTLQPTAAPNTHLVEDLNRTGPLSVTTPQSHSQNFSTLHGEPEEDENYPTTSILPSSTKSSAKDARRGGSLPTDTTTSVEGYTFQYPDTMENGTLFPVTPAKTEVFGETEVTLATDSNVNVDGSLPGDRDSSKDSRGSSRTVTHGSELAGHSSANQDSGVTTTSGPMRRPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINGGNGTVEDRKPSELNGEASKSQEMVHLVNKEPSETPDQCMTADETRNLQSVDMKIGV Main cell surface receptor for hyaluronate. Adhesion to mucosal high endothelial venule and to types I and VI collagen. Probably involved in matrix adhesion, lymphocyte activation and lymph node homing mint tgfr1_mouse TGF-beta receptor type-1 Tgfbr1 Transforming growth factor-beta receptor type I ESK2 protein protein mouse Mus musculus Mouse MEAAAAAPRRPQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGIKM leg9_mouse Galectin-9 Lgals9 protein protein mouse Mus musculus Mouse MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT Binds galactosides. May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. Is a ligand for HAVCR2/TIM3. Induces T-helper type 1 lymphocyte (Th1) death mint leg9_mouse_gene Galectin-9 Lgals9 gene gene mouse Mus musculus Mouse smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS foxo3_mouse_gene Forkhead box protein O3 Foxo3 Fkhr2 Foxo3a gene gene mouse Mus musculus Mouse h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG cd44-tgfbr1-1 1855283 N/A 1855287 unspecified role unspecified role bait bait N/A 1855288 unspecified role unspecified role prey prey physical association physical association false false false 5A This interaction was only seen in cells from WT mice, and not from cells of Lgals9–/– mice. cd44-tgfbr1-2 1855283 N/A 1855287 unspecified role unspecified role prey prey N/A 1855288 unspecified role unspecified role bait bait physical association physical association false false false 5A-2 This interaction was only seen in cells from WT mice, and not from cells of Lgals9–/– mice. cd44-tgfbr1-4 1855283 N/A 1855289 unspecified role unspecified role prey prey N/A 1855287 unspecified role unspecified role bait bait physical association physical association false false false Supp 5C cd44-lgals9-1 1855283 N/A 1855289 unspecified role unspecified role bait bait N/A 1855287 unspecified role unspecified role prey prey physical association physical association false false false Supp 5C-2 smad3-lgals9-1 1855284 N/A 1855290 unspecified role unspecified role prey prey multiple_regions sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855291 unspecified role unspecified role bait bait association association false false false 2C Q8BUN5 increases expression at RNA level of ENSMUSG00000001123 Q8BUN5 increases expression at protein level of ENSMUSG00000001123 This interaction was not seen in Th0 (precursor) cells. P01137 increases expression at protein level of ENSMUSG00000001123 P01137 increases expression at RNA level of ENSMUSG00000001123 foxo3-smad3-1 1855284 N/A 1855292 unspecified role unspecified role prey prey cns1_enhancer__region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855291 unspecified role unspecified role bait bait association association false false false 6A, Supp 6B, (S1C) O00182-2 increases expression at protein level of ENSMUSG00000048756 Q8BUN5 increases expression at RNA level of ENSMUSG00000048756 Q8BUN5 increases expression at protein level of ENSMUSG00000048756 O08573 increases binding of Q8BUN5 to ENSMUSG00000048756 P15379 is required for the expression at protein level of ENSMUSG00000048756 A substantial synergistic effect of galectin-9 (O00182-2) with TGF-beta in inducing Foxp3 expression was observed. Lactose inhibited this expression. O08573 is required for binding of Q8BUN5 to ENSMUSG00000048756 No binding of Smad3 to Foxp3 CNS1 region is seen in Th0 (precursor) cells. O00182-2 increases expression at RNA level of ENSMUSG00000048756 P01137 increases expression at protein level of ENSMUSG00000048756 CHEBI:17716 inhibits P01137 and O00182-2 induced increase in expression at protein level of ENSMUSG00000048756 CHEBI:17716 indirectly decreases expression at protein level of ENSMUSG00000048756 hist1h4h-foxo3-1 1855284 N/A 1855292 unspecified role unspecified role prey prey cns1_enhancer__region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1855293 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 6 A/B O08573 increases binding of P62806 to ENSMUSG00000048756 O00182-2 increases binding of P62806 to ENSMUSG00000048756 TGF-beta and galectin-9 P01137 increases binding of P62806 to ENSMUSG00000048756 smad3-lgals9-2 1855285 N/A 1855287 unspecified role unspecified role neutral component neutral component N/A 1855288 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 5A This interaction was only seen in cells from WT mice, and not from cells of Lgals9–/– mice. TGF-beta cd44-tgfbr1-3 1855286 N/A 1855287 unspecified role unspecified role neutral component neutral component N/A 1855288 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false 5C