IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ inoue-2014-2 mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Bone marrow (BM)-derived macrophage or peritoneal macrophages mari.shinohara@duke.edu Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation inoue-2014-3 mouse-macrophage Mus musculus macrophage macrophage Macrophage confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Supp fig 6 - Splenic macrophages Cells were treated with LPS or LPS and anti-CD40. mari.shinohara@duke.edu Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation inoue-2014-1 mouse-macrophage Mus musculus macrophage macrophage Macrophage ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML., Inoue M., Arikawa T., Chen YH., Moriwaki Y., Price M., Brown M., Perfect JR., Shinohara ML. IBD - Inflammatory bowel disease Peritoneal macrophages treated with LPS and CD40 antibody. mari.shinohara@duke.edu Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation irf5_mouse Interferon regulatory factor 5 Irf5 protein protein mouse Mus musculus Mouse MNHSAPGIPPPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFYIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFQLFYDGPRDMPPQPYKIYEVCSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITEPALPGPPNAPYSLPKEDTKWPPALQPPVGLGPPVPDPNLLAPPSGNPAGFRQLLPEVLEPGPLASSQPPTEPLLPDLLISPHMLPLTDLEIKFQYRGRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCALAHGSCPNPIQREVKTKLFSLEQFLNELILFQKGQTNTPPPFEIFFCFGEEWPDVKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDHMVEQFKELHHLWQSQQQLQPMVQAPPVAGLDASQGPWPMHPVGMQ irak1_mouse Interleukin-1 receptor-associated kinase 1 Pelle-like protein kinase Irak1 Il1rak protein protein mouse Mus musculus Mouse MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPAFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTKSSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKEEADLEWTMVKQSFLTEVEQLSRFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQLHLQTQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLMPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVILETLAGQRAVRTQGAKTKYLKDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEGSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPGLDLEPEKSQGPEESDEFQS traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL ostp_mouse Osteopontin Spp1 Eta-1 Op Spp-1 2AR Bone sialoprotein 1 Calcium oxalate crystal growth inhibitor protein Early T-lymphocyte activation 1 protein Minopontin Secreted phosphoprotein 1 protein protein mouse Mus musculus Mouse MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN il10_mouse_gene Interleukin-10 gene gene gene mouse Mus musculus Mouse irak1-irf5-1 1860795 N/A 1860798 unspecified role unspecified role prey prey N/A 1860799 unspecified role unspecified role bait bait physical association physical association false false false 4F, 5D LPS plus CD40 antibody LPS Traf2 shRNA irak1-traf2-1 1860795 N/A 1860800 unspecified role unspecified role prey prey N/A 1860799 unspecified role unspecified role bait bait physical association physical association false false false 5A LPS plus CD40 antibody irak1-spp1-2 1860795 N/A 1860801 unspecified role unspecified role bait bait N/A 1860799 unspecified role unspecified role prey prey physical association physical association false false false 6B LPS plus CD40 antibody irak1-traf2-2 1860795 N/A 1860800 unspecified role unspecified role bait bait N/A 1860799 unspecified role unspecified role prey prey physical association physical association false false false 6A, 6D LPS plus CD40 antibody OPN knockout. irak1-irf5-2 1860796 N/A 1860798 unspecified role unspecified role neutral component neutral component N/A 1860799 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4G, Supp Fig 6 LPS alone (Supp fig 6) or LPS plus CD40 antibody irak1-spp1-1 1860796 N/A 1860801 unspecified role unspecified role neutral component neutral component N/A 1860799 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A LPS plus CD40 antibody Opn-i - an intracellular isoform of OPN with a deletion of the N-terminal 16-aa signal sequence, is stated to have been detected, but the antibody used (sc-21742) would not appear to distinguish between isoforms. irak1-il10_mouse_gene-1 1860797 N/A 1860799 unspecified role unspecified role bait bait N/A 1860802 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4C Q62406 increases the expression at protein level of ENSMUSG00000016529 P18893 decreases the expression at the RNA level of ENSMUSG00000024401