IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tone-2014-2 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Tone Y., Kidani Y., Ogawa C., Yamamoto K., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease Results from Figure 7E have not been included as the origin of the construct "FLAG-tagged Foxp3" is not stated, and the corresponding author did not reply to a request for information. In figure 4 a Nuclear extract from CD3-activated EL4 cells were used. In Supplementary figure 3 a Nuclear extract from non-activated EL4 cells were used. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation tone-2014-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tone Y., Kidani Y., Ogawa C., Yamamoto K., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease Results from Figure 7E have not been included as the origin of the construct "FLAG-tagged Foxp3" is not stated, and the corresponding author did not reply to a request for information. CD4+CD25− T cells stimulated with anti-CD3/28 and TFG-beta, or unstimulated CD4+CD25− T cells. Sequence of the "kB" (kB1 + kB2 regions) probe used was deduced from one primer stated in methods section (GAAACACC ACAGGTGGGACA) and 101bp added to this sequence using sequence given in Fig 3A. kB1 and FoxP3 Probe sequences were taken from Fig 7A. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation tone-2014-1 mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Tone Y., Kidani Y., Ogawa C., Yamamoto K., Tsuda M., Peter C., Waldmann H., Tone M. IBD - Inflammatory bowel disease Results from Figure 7E have not been included as the origin of the construct "FLAG-tagged Foxp3" is not stated, and the corresponding author did not reply to a request for information. T cells activated by anti-CD3, also CD4+CD25− T cells, nTreg cells and induced TReg cells. Masahide.Tone@csmc.edu Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation p25799-pro_0000030313 Nuclear factor NF-kappa-B p50 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG 0597F8EA07635A94 1 431 nfkb_b1_site_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse CACCACAGGTGGGACATCCCCAAACAGA tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS nfkb_b2_site_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse ATGTGCTGGAAACCCCTCCTGTGGGG nfkb_b3_site_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse TTAGATCTGGGGATTTCCACTAAG sp1_mouse Transcription factor Sp1 Sp1 Specificity protein 1 protein protein mouse Mus musculus Mouse MSDQDHSMDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGNSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGGLQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRREACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNGF sp3_mouse Transcription factor Sp3 Sp3 protein protein mouse Mus musculus Mouse MTAPEKPVKQEEMAALDVDGGGGGGGHGEYLQQQQQQQQQHGNGAAAAAAQDTQPSPLALLAATCSKIGPPSPGDDDEEAAVAAAAGVPAAAAGATGDLASAQLGGAPNRWEVLSATPTTIKDEAGNLVQIPGAATSSGQYVLPLQNLQNQQIFSVAPGSDSSNGTVSNVQYQVIPQIQSTDAQQVQIGFTGSSDNGGINQENSQIQIIPGSNQTLLASGTPPANIQNLIPQTGQVQVQGVAIGGSSFPGQTQVVANVPLGLPGNITFVPINSVDLDSLGLSGSSQTMTAGINADGHLINTGQAMDSSDNSERTGERVSPDVNETNADTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTTSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQDSQQPTSQAQIVQGITPQTIHGVQASGQNISQQALQNLQLQLNPGTFLIQAQTVTPSGQITWQTFQVQGVQNLQNLQIQNTAAQQITLTPVQTLTLGQVAAGGALTSTPVSLSTGQLPNLQTVTVNSIDSTGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFICNWMFCGKRFTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKVIHSSSTVLASVEAGRDDALITAGGTTLILANIQQGSVSGIGTVNTSATSNQDILTNTEIPLQLVTVSGNETME kb_probe_enhancer_b1+b2_sites dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GAAACACCACAGGTGGGACATCCCCAAACAGATGACGTGTGTGCAAATACCCACAGGCTGTATGTGCTGGAAACCCCTCCTGTGGGCGGCTG foxp3_mouse Forkhead box protein P3 Foxp3 Scurfin protein protein mouse Mus musculus Mouse MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEKVFEEPEEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMDKSSCCIVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAILEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQRPNKCSNPCP bcl3_mouse B-cell lymphoma 3 protein homolog Bcl3 protein protein mouse Mus musculus Mouse MPRCPAGAMDEGPVDLRTRPKGTPGAALPLRKRPLRPASPEPATTRSPAGPLDALRSGCDVPVVPGPPHCVARPEALYYQGPLMPIYSTPTMAPHFPLLNLPTHPYSMICPMEHPLSADIAMATRVDEDGDTPLHIAVVQNNIAAVYRILSLFKLGSREVDVHNNLRQTPLHLAVITTLPDMVRLLVTAGASPMALDRHGQTAIHLACEHRSPSCLQALLDSATSGSVDLEVRNYEGLTALHVAVNTGCQEAVLLLLERGADIDAVDIKSGRSPLIHAVENNSLNMVQLLLLHGANVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRGKASRAASGSQPEPSPDQSATNSPESSSRLSSNGLQSSPSSSPSLSPPKDAPGFPATPQNFFLPTTSTPAFLPFPGVLRGPGRPVPPSPAPGSS rel_mouse Proto-oncogene c-Rel Rel protein protein mouse Mus musculus Mouse MASSGYNPYVEIIEQPRQRGMRFRYKCEGRSAGSIPGERSTDNNRTYPSVQIMNYYGKGKIRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGPERRPLFFQNLGIRCVKKKEVKGAIILRISAGINPFNVGEQQLLDIEDCDLNVVRCVFMFFLPDEDGNFTTALPPIVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEARGVFSQADVHRQVAIVFKTPPYCKAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQDCGHFTEKPRTAPLGSTGEGRFIKKESNLFSHGTVLPEMPRSSGVPGQAEPYYSSCGSISSGLPHHPPAIPSVAHQPTSWPPVTHPTSHPVSTNTLSTFSAGTLSSNSQGILPFLEGPGVSDLSASNSCLYNPDDLARMETPSMSPTDLYSISDVNMLSTRPLSVMAPSTDGMGDTDNPRLVSINLENPSCNARLGPRDLRQLHQMSPASLSAGTSSSSVFVSQSDAFDRSNFSCVDNGLMNEPGLSDDANNPTFVQSSHYSVNTLQSEQLSDPFTYGFFKI competitor_b1_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse AGGTGGGACATCCCCAAACAGATGA cd40/nfkb_competitor_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse CCCTGGGAAGGTCCTGGGGAAATCCCTGCT foxp3_competitor_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse CCCAAACAGAATGACGTGTGTGCAAAATACCCA tnr18_mouse_gene Tumor necrosis factor receptor superfamily member 18 Tnfrsf18 Gitr gene gene mouse Mus musculus Mouse h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG nfkb_b1_region_probe-nfkb1-2 1859566 N/A 1859569 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859570 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4C nfkb_b1_region_probe-rela-1 1859566 N/A 1859571 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859570 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Ci nfkb_b2_site_probe-nfkb1-2 1859566 N/A 1859569 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859572 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Cii nfkb_b2_site_probe-nfkb1-1 1859566 N/A 1859571 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859572 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Ciii nfkb_b3_site_probe-rela-1 1859566 N/A 1859571 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859573 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Civ nfkb_b3_site_probe-rela-2 1859566 N/A 1859569 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859573 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4Cv nfkb_b1_site_probe-nfkb1-1 1859566 N/A 1859574 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859570 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 3B nfkb_b2_site_probe-sp3-1 1859566 N/A 1859575 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line N/A 1859572 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp 3B nfkb_b1_site_probe-sp1-1 1859566 N/A 1859570 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859575 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line physical association physical association false false false Supp 3Bi nfkb_b2_site_probe-sp3-2 1859566 N/A 1859572 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859574 unspecified role unspecified role prey prey mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line physical association physical association false false false Supp 3Bii kb_probe_enhancer_b1+b2_sites-foxp3-1 1859567 N/A 1859576 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false N/A 1859577 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859569 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859578 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859579 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859571 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ association association false false false 7 B/C Non-stimulated cells showed no binding. kb_probe_enhancer_b1+b2_sites-bcl3-1 1859567 N/A 1859580 competitor competitor competitor prey prey N/A 1859576 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false N/A 1859577 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859569 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859578 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859579 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ N/A 1859571 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ association association false false false 7 B/Ci kb_probe_enhancer_b1+b2_sites-bcl3-3 1859567 N/A 1859581 competitor competitor competitor prey prey N/A 1859576 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false N/A 1859569 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ association association false false false 7 D Foxp3 binding was only minimally affected by competition from a probe containing a p50 binding site;however p50 binding was not completely inhibited. kb_probe_enhancer_b1+b2_sites-bcl3-4 1859567 N/A 1859582 competitor competitor competitor prey prey N/A 1859576 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false N/A 1859569 unspecified role unspecified role prey prey mouse-t-cell_cd4+ Mouse CD4 positive T-cell t-cell_cd4+ t cell cd4+ association association false false false 7 B/Cii-B p50 binding to the enhancer probe was reduced as a result of inhibition of Foxp3 binding; however binding of Foxp3, p65,c-Rel and Bcl-3 was abolished. hist1h4h-tnfsf18-1 1859568 N/A 1859583 unspecified role unspecified role prey prey B1+B2_sites_nfkb_binding_region_of enhancer sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false B3_site_nfkb_binding_region_of enhancer sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859584 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 2 F/G Histone H4 was highly acetylated in nTreg and T cells activated by anti-CD3 treatment, but not in naive CD4+CD25− T cells. nfkb1-tnfsf18-1 1859568 N/A 1859583 unspecified role unspecified role prey prey B1+B2_sites_nfkb_binding_region_of enhancer sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false B3_site_nfkb_binding_region_of enhancer sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1859569 unspecified role unspecified role bait bait association association false false false 5A, 6 A/B p50 binding to the kB1 plus κB2 and kB3 regions was increased in T cells 24 h after CD3 activation. Binding was detected in nTreg and induced TReg cells, but not in naive CD4+CD25– T cells. A NF-kB activation inhibitor, identity unknown, reduces the expression at protein level of ENSMUSG00000066755 P25799-PRO_0000030313 increases expression at the protein level of ENSMUSG00000041954 (in anti-CD3 stimulated or Foxp3+ cells)