IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nie-2013-2 human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease Treg cells (CD4+CD25hiCD127lo/−) Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Nature medicine 2013 Only protein-protein interactions imex curation imex curation nie-2013-3 in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease This assay is stated to detect dephosphorylation of peptides by measuring "absorbance at 650nm": the assay method is most likely based on the formation of a complex between malachite green molybdate and free orthophosphate that absorbs at 620-640 nm. Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Nature medicine 2013 Only protein-protein interactions imex curation imex curation nie-2013-1 human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Nie H., Zheng Y., Li R., Guo TB., He D., Fang L., Liu X., Xiao L., Chen X., Wan B., Chin YE., Zhang JZ. IBD - Inflammatory bowel disease It has been assumed the same cells were used in fig 3E and Supp fig 6, but no cell line ot type is stated for Fig 3E. CD4+ T cells expressing various FOXP3 mutants Interactions from figure 5 using PP1, TNF-a and POXP3 constructs, could not be curated since the PP1 and TNF-a constructs species could not be ascertained. jingwu.z.zang@gsk.com Nature medicine 2013 Only protein-protein interactions imex curation imex curation foxp3_human Forkhead box protein P3 Scurfin FOXP3 IPEX JM2 protein protein human Homo sapiens Human MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSSLNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKDSTLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK pp1a_rabit Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK b6zgu2_human NR2F6 protein protein human Homo sapiens Human MVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRTIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHGFFPELPVADQVALLRMSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human foxp3-ppp1ca-1 1854144 N/A 1854147 unspecified role unspecified role bait bait N/A 1854148 unspecified role unspecified role prey prey physical association physical association false false false 5B ppp1ca-foxp3-1 1854144 N/A 1854147 unspecified role unspecified role prey prey N/A 1854148 unspecified role unspecified role bait bait physical association physical association false false false 5B foxp3-ppp1ca-2 1854145 N/A 1854147 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ser418 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1854149 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false 5D foxp3-ppp1ca-3 1854145 N/A 1854150 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false thr81 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1854149 enzyme enzyme neutral component neutral component ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false 5D-2 Control peptide assay;(KRpTIRR) The equivalent curated Swiss-Prot entry (P10588) for the control peptide records a "sequence confilict" and the equivalent sequence is stated as KRSIRR. foxp3-il2_human_gene-3 1854146 N/A 1854147 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false Q9BZS1:p.[Ser418Ala;Ser422Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1854151 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 3E, supp fig 6 Q9BZS1 inhibits expression at RNA level of ENSG00000109471 mRNA and protein expression of the S418A FOXP3 mutant is not decreased by binding to IL2 promoter. CHEBI:10037 decreases expression at protein level of P62136