IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2013-5 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. primary CD4+ T cells 48 h after iTreg induction. jingwu.z.zang@gsk.com Journal of molecular cell biology 2013 Only protein-protein interactions imex curation imex curation zhang-2013-6 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Q., Cui F., Fang L., Hong J., Zheng B., Zhang JZ. IBD - Inflammatory bowel disease Results from figure 6G have not been included due to the use of a non-specific "AKT" antibody, and the origin of the "AA" mutant are not stated. nuclear extracts from CD4+ T cells 24 h after iTreg induction jingwu.z.zang@gsk.com Journal of molecular cell biology 2013 Only protein-protein interactions imex curation imex curation foxp3_promoter_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GAAGAGCGAGGTCTGCGGCTTCCACGCCG smad3_mouse Mothers against decapentaplegic homolog 3 Smad3 Madh3 SMAD family member 3 protein protein mouse Mus musculus Mouse MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS nfac1_mouse Nuclear factor of activated T-cells, cytoplasmic 1 Nfatc1 Nfat2 Nfatc NFAT transcription complex cytosolic component protein protein mouse Mus musculus Mouse MPNTSFPVPSKFPLGPPAAVCGSGETLRPAPPSGGTMKAAEEEHYSYVSPSVTSTLPLPTAHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESPRIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSPSTSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTEDTWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLGTTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEIPPFRNQRITSPAQVSFYVCNGKRKRSQYQRFTYLPANGNSVFLTLSSESELRGGFY mint Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 or IL-4 gene transcription. Also controls gene expression in embryonic cardiac cells. Could regulate not only the activation and proliferation but also the differentiation and programmed death of T-lymphocytes as well as lymphoid and non-lymphoid cells foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse foxp3_promoter_probe-smad3-1 1859031 N/A 1859033 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1859034 unspecified role unspecified role prey prey ser423,ser425 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes physical association physical association false false false 5H foxp3_promoter_probe-smad3-2 1859031 N/A 1859035 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes N/A 1859033 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Supp 14 smad3-foxp3-4 1859032 N/A 1859034 unspecified role unspecified role bait bait N/A 1859036 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5J P06804 (TNF-alpha) P06804 decreases binding of Q8BUN5 to ENSMUSG00000039521 CHEBI:65329 indirectly increases at the protein level the expression of ENSMUSG00000039521 P06804 increases the phosphorylation of P31750 P06804 decreases the phosphorylation of Q8BUN5 CHEBI:65329 indirectly increases the phosphorylation of Q8BUN5 CHEBI:65329 indirectly inhibits the phosphorylation of P31750 CHEBI:65329 decreases the inhibition of expression at protein level of ENSMUSG00000039521 by P06804 P06804 indirectly decreases at RNA level the expression of ENSMUSG00000039521