IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zonta-2013-3 The RNA helicase DDX5/p68 is a key factor promoting c-fos expression at different levels from transcription to mRNA export. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells rna-ip rna immunoprecipitation rna-ip rt-pcr reverse transcription pcr RT-PCR Zonta E., Bittencourt D., Samaan S., Germann S., Dutertre M., Auboeuf D. IBD - Inflammatory bowel disease The authors previously confirmed the human origin of HA-tagged Ddx5 (see interaction EBI-6374332). The molecule "TAP" was identified by a blat of primers, are also by reference to suppliers details for antibodies used for detection. didier.auboeuf@inserm.fr Nucleic Acids Res. (0305-1048) 2013 Only protein-protein interactions imex curation zonta-2013-2 The RNA helicase DDX5/p68 is a key factor promoting c-fos expression at different levels from transcription to mRNA export. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zonta E., Bittencourt D., Samaan S., Germann S., Dutertre M., Auboeuf D. IBD - Inflammatory bowel disease The authors previously confirmed the human origin of HA-tagged Ddx5 (see interaction EBI-6374332). The molecule "TAP" was identified by a blat of primers, are also by reference to suppliers details for antibodies used for detection. didier.auboeuf@inserm.fr Nucleic Acids Res. (0305-1048) 2013 Only protein-protein interactions imex curation zonta-2013-1 The RNA helicase DDX5/p68 is a key factor promoting c-fos expression at different levels from transcription to mRNA export. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zonta E., Bittencourt D., Samaan S., Germann S., Dutertre M., Auboeuf D. IBD - Inflammatory bowel disease The authors previously confirmed the human origin of HA-tagged Ddx5 (see interaction EBI-6374332). The molecule "TAP" was identified by a blat of primers, are also by reference to suppliers details for antibodies used for detection. didier.auboeuf@inserm.fr Nucleic Acids Res. (0305-1048) 2013 Only protein-protein interactions imex curation zonta-2013-4 The RNA helicase DDX5/p68 is a key factor promoting c-fos expression at different levels from transcription to mRNA export. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zonta E., Bittencourt D., Samaan S., Germann S., Dutertre M., Auboeuf D. IBD - Inflammatory bowel disease The authors previously confirmed the human origin of HA-tagged Ddx5 (see interaction EBI-6374332). The molecule "TAP" was identified by a blat of primers, are also by reference to suppliers details for antibodies used for detection. didier.auboeuf@inserm.fr Nucleic Acids Res. (0305-1048) 2013 Only protein-protein interactions imex curation rpb1_human DNA-directed RNA polymerase II subunit RPB1 POLR2A DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit POLR2 RNA-directed RNA polymerase II subunit RPB1 protein protein human Homo sapiens Human MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPASPKYTPTSPSYSPSSPEYTPTSPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN fos_human_mrna Proto-oncogene c-Fos (FOS) human mRNA mrna messenger rna mRNA mrna human Homo sapiens Human thoc4_human THO complex subunit 4 ALYREF ALY Ally of AML-1 and LEF-1 Aly/REF export factor BEF THOC4 Transcriptional coactivator Aly/REF bZIP-enhancing factor BEF protein protein human Homo sapiens Human MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS nxf1_human Nuclear RNA export factor 1 NXF1 TAP Tip-associating protein Tip-associated protein mRNA export factor TAP protein protein human Homo sapiens Human MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVAMSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAFMK ddx5_human Probable ATP-dependent RNA helicase DDX5 HLR1 DDX5 HELR G17P1 DEAD box protein 5 RNA helicase p68 protein protein human Homo sapiens Human MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ exosx_human Exosome component 10 PMSCL2 EXOSC10 PMSCL Polymyositis/scleroderma autoantigen 2 Autoantigen PM/Scl 2 Polymyositis/scleroderma autoantigen 100 kDa P100 polymyositis-scleroderma overlap syndrome-associated autoantigen RRP6 protein protein human Homo sapiens Human MAPPSTREPRVLSATSATKSDGEMVLPGFPDADSFVKFALGSVVAVTKASGGLPQFGDEYDFYRSFPGFQAFCETQGDRLLQCMSRVMQYHGCRSNIKDRSKVTELEDKFDLLVDANDVILERVGILLDEASGVNKNQQPVLPAGLQVPKTVVSSWNRKAAEYGKKAKSETFRLLHAKNIIRPQLKFREKIDNSNTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELVELNEKLLNCQEFAVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQYQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR fos_human_gene Human FOS gene gene gene human Homo sapiens Human polr2a-fos-1 1771576 n/a 1771580 unspecified role unspecified role bait bait n/a 1771581 unspecified role unspecified role prey prey 3-prime utr-3 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon4 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 3-prime utr-1 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3f, 4c, Suppl. Fig. S4c polr2a-fos-2 1771576 n/a 1771580 unspecified role unspecified role bait bait n/a 1771581 unspecified role unspecified role prey prey exon1/2-exon3/4 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon1/2-intron2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 3g, 3h, 4d, 4e anti-Ddx5 (P17844) siRNA polr2a-fos-3 1771576 n/a 1771580 unspecified role unspecified role bait bait n/a 1771581 unspecified role unspecified role prey prey exon2/intron2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon1/intron1 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4c anti-Ddx5 (P17844) siRNA Primers are located in introns 1 and 2; Increased binding with DDX5 depletion is shown using this primer set, while using other primer sets a decrease in binding is seen. alyref-fos 1771576 n/a 1771582 unspecified role unspecified role bait bait n/a 1771581 unspecified role unspecified role prey prey exon1/2-exon3/4 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6c anti-Ddx5 (P17844) siRNA nxf1-fos 1771576 n/a 1771583 unspecified role unspecified role bait bait n/a 1771581 unspecified role unspecified role prey prey exon1/2-exon3/4 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6d anti-Ddx5 (P17844) siRNA P17844 increases binding of Q9UBU9 to ENST00000303562 ddx5-fos-1 1771576 n/a 1771581 unspecified role unspecified role prey prey n/a 1771584 unspecified role unspecified role bait bait physical association physical association false false false Fig. 7a estradiol (E2) (CHEBI:23965) CHEBI:23965 increases binding of P17844 to ENST00000303562 ddx5-fos-2 1771576 n/a 1771581 unspecified role unspecified role prey prey n/a 1771584 unspecified role unspecified role bait bait engineered engineered region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7b An inducible MCF-7/Tet-on stable cell line was used, in which expression of HA-tagged Ddx5 was induced by doxycycline (DOX) treatment (1 microgram/ml for 48 hours). exosc10-ddx5 1771577 n/a 1771584 unspecified role unspecified role prey prey n/a 1771585 unspecified role unspecified role bait bait physical association physical association false false false Fig. 5a ddx5-exosc10 1771577 n/a 1771584 unspecified role unspecified role bait bait n/a 1771585 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5a alyref-ddx5 1771577 n/a 1771582 unspecified role unspecified role bait bait n/a 1771584 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7c RNase A nxf1-ddx5 1771577 n/a 1771583 unspecified role unspecified role bait bait n/a 1771584 unspecified role unspecified role prey prey physical association physical association false false false Fig. 7c RNase A polr2a-fos 1771578 n/a 1771586 unspecified role unspecified role prey prey exon1/intron1 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon4 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon2/intron2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 3-prime utr-2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1771580 unspecified role unspecified role bait bait association association false false false Fig. 2b, 4b, 5e estradiol (E2) (CHEBI:23965) anti-Ddx5 (P17844) siRNA In the absence of E2, anti-Ddx5 siRNA did not affect the level of RNAPII/RPB1 on the c-fos gene. CHEBI:23965 increases binding of P24928 to ENSG00000170345 P17844 increases binding of P24928 to ENSG00000170345 ddx5-fos 1771578 n/a 1771584 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1771586 unspecified role unspecified role prey prey estrogen receptor binding site (erbs) region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2c estradiol (E2) (CHEBI:23965) CHEBI:23965 increases binding of P17844 to ENSG00000170345 P17844 increases expression at RNA level of ENSG00000170345 CHEBI:23965 indirectly increases expression at RNA level of ENSG00000170345 P17844 increases expression at protein level of ENSG00000170345 CHEBI:23965 indirectly increases expression at protein level of ENSG00000170345 While depletion of Ddx5 resulted in decreased total (Fig. 1B) and cytosolic (Fig. 3B) c-Fos mRNA, an increased nuclear accumulation of c-Fos mRNA was observed under these conditions (Fig. 3C). exosc10-fos 1771578 n/a 1771586 unspecified role unspecified role prey prey exon1/intron1 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false exon2/intron2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 3-prime utr-2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1771585 unspecified role unspecified role bait bait association association false false false Fig. 5d, 5e estradiol (E2) (CHEBI:23965) anti-Ddx5 (P17844) siRNA Anti-Ddx5 siRNA mainly affected binding of Rrp6/Exosx to the 3-prime UTR region of the c-fos gene, but not to the exon1/intron1 and eon2/intron2 regions. CHEBI:23965 increases binding of Q01780 to ENSG00000170345 P17844 increases binding of Q01780 to ENSG00000170345 ddx5-exosc10-1 1771579 n/a 1771585 unspecified role unspecified role neutral component neutral component n/a 1771584 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 5b