IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ puthenedam-2011-1 in vitro In vitro cleavage cleavage assay cleavage weight by comassie molecular weight estimation by coomasie staining weight by comassie Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation puthenedam-2011-2 in vitro In vitro cleavage cleavage assay cleavage fingerprinting peptide massfingerprinting fingerprinting Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation puthenedam-2011-3 in vitro In vitro cleavage cleavage assay cleavage partial id prot seq partial identification of protein sequence partial id prot seq Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease jkwon@medicine.bsd.uchicago.edu Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation puthenedam-2011-4 in vitro In vitro cleavage cleavage assay cleavage western blot western blot Immuno blot Immuno blot Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease Cleavage reaction products were detected with an anti-galectin-3 C-terminus antibody and an anti-galectin-3 N-terminus antibody. jkwon@medicine.bsd.uchicago.edu Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation puthenedam-2011-5 human-t84 Homo sapiens colon carcinoma t84 human colon carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH., Puthenedam M., Wu F., Shetye A., Michaels A., Rhee KJ., Kwon JH. IBD - Inflammatory bowel disease Cleavage reaction products were detected with an anti-galectin-3 C-terminus antibody and an anti-galectin-3 N-terminus antibody. jkwon@medicine.bsd.uchicago.edu Inflammatory bowel diseases 2011 Only protein-protein interactions imex curation imex curation leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI mmp7_human Matrilysin MMP7 MPSL1 Matrin Matrix metalloproteinase-7 PUMP1 Pump-1 protease Uterine metalloproteinase protein protein human Homo sapiens Human MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK lgals3-mmp7-1 1860677 N/A 1860682 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 1860683 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false 1 lgals3-mmp7-2 1860678 N/A 1860682 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 1860683 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false 2A lgals3-mmp7-3 1860679 N/A 1860682 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 1860683 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false 2 B/C lgals3-mmp7-4 1860680 N/A 1860682 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 1860683 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) protein cleavage protein cleavage false false false 3 Galectin-3 cleavage products were only detected with the anti-galectin-3 C-terminus antibody, suggesting that MMP7 cleaves galectin-3 N-terminal sites. lgals3-mmp7-5 1860681 N/A 1860682 unspecified role unspecified role neutral component neutral component N/A 1860683 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4 co-localization was observed at the edge of the colonies.