IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2010d-1 CCAAT/enhancer-binding protein β and NF-κB mediate high level expression of chemokine genes CCL3 and CCL4 by human chondrocytes in response to IL-1β. human-tc28a2 Homo sapiens T/C-28a2 chondrocyte cell line tc-28a2 Human chondrocyte cell line T/C-28a2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Z., Bryan J.L., DeLassus E., Chang L.W., Liao W., Sandell L.J. IBD - Inflammatory bowel disease sandelll@wustl.edu J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation zhang-2010d-2 CCAAT/enhancer-binding protein β and NF-κB mediate high level expression of chemokine genes CCL3 and CCL4 by human chondrocytes in response to IL-1β. in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift autoradiography autoradiography Zhang Z., Bryan J.L., DeLassus E., Chang L.W., Liao W., Sandell L.J. IBD - Inflammatory bowel disease sandelll@wustl.edu J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation ccl3_human_gene C-C motif chemokine 3 (CCL3) human gene CCL3 G0S19-1 MIP1A SCYA3 gene gene human Homo sapiens Human cebpb_human CCAAT/enhancer-binding protein beta CEBPB TCF5 PP9092 Liver activator protein Nuclear factor NF-IL6 Transcription factor 5 Liver-enriched inhibitory protein protein protein human Homo sapiens Human MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC ccl4_human_gene C-C motif chemokine 4 (CCL4) human gene gene gene human Homo sapiens Human ccl3_human_cebpb-site_dna-probe Human CCL3 gene promoter CEBPB binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CCTTGGGTTGACATATACCCCTCT ccl4_human_cebpb-site_dna-probe Human CCL4 gene promoter CEBPB binding site DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human CTTTCCTCTATGATGACATCGCCCT cebpb-ccl3-1 1575424 n/a 1575426 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1575427 unspecified role unspecified role bait bait association association false false false Fig. 5a, 5b, 5c, 5e Interleukin-1 beta (IL-1beta) P17676 increases expression at RNA level of ENSG00000277632 cebpb-ccl4-1 1575424 n/a 1575428 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1575427 unspecified role unspecified role bait bait association association false false false Fig. 5a, 5b, 5d Interleukin-1 beta (IL-1beta) P17676 increases expression at RNA level of ENSG0000275302 ccl3-cebpb-1 1575425 n/a 1575429 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1575427 unspecified role unspecified role prey prey human-tc28a2 Homo sapiens T/C-28a2 chondrocyte cell line tc-28a2 Human chondrocyte cell line T/C-28a2 physical association physical association false false false Fig. 4c ccl4-cebpb-1 1575425 n/a 1575427 unspecified role unspecified role prey prey human-tc28a2 Homo sapiens T/C-28a2 chondrocyte cell line tc-28a2 Human chondrocyte cell line T/C-28a2 n/a 1575430 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4c