IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ harada-2010-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease Where used, mouse T cell lysates from naive CD4 T cells stimulated with anti-CD3, anti-CD28, and TGF-beta were mixed with biotinylated DNA probes. The Foxo3a "H212R" mutant had been entered as H211R as there is no histidine residue at position 212 according to UniProt Q9WVH4. DNA probe sequences have been taken from Figure 5B. yuncail@liai.org The Journal of experimental medicine 2010 Only protein-protein interactions imex curation imex curation harada-2010-2 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease Mouse T cell lysates from naive CD4 T cells stimulated with anti-CD3, anti-CD28, and TGF-beta. yuncail@liai.org The Journal of experimental medicine 2010 Only protein-protein interactions imex curation imex curation foxp3_proximal_promoter_foxo_binding _site_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GTTGTTTTT foxo3_mouse Forkhead box protein O3 Foxo3 Fkhr2 Foxo3a protein protein mouse Mus musculus Mouse MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEDDDEDDEDGGGRASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSGGTPTQLQPQQPLPQPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSHSDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse foxp3_proximal_promoter_foxo_binding _site_probe-foxo3-1 1857985 N/A 1857987 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1857988 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes physical association physical association false false false 5 C foxp3_proximal_promoter_foxo_binding _site_probe-foxo3-2 1857985 N/A 1857987 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 1857988 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey undefined mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 5 D foxp3_proximal_promoter_foxo_binding _site_probe-foxo1-1 1857985 N/A 1857989 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes N/A 1857987 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false 6F foxo3-foxp3-1 1857986 N/A 1857990 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1857988 unspecified role unspecified role bait bait physical association physical association false false false 5 E Q9WVH4 increases expression at protein level of ENSMUSG00000039521 Q9R1E0 increases expression at protein level of ENSMUSG00000039521 CHEBI:65329 indirectly increases expression at protein level of ENSMUSG00000039521 Q3TTA7 indirectly increases expression at protein level of ENSMUSG00000039521