IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ahyi-2009-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease The sequence for the competitor "lambda-B" (enhancer) oligonucleotide was derived from Reference 24 (pmid;12453417). mkaplan2@iupui.edu Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation ahyi-2009-3 mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation ahyi-2009-2 mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Ahyi AN., Chang HC., Dent AL., Nutt SL., Kaplan MH. IBD - Inflammatory bowel disease mkaplan2@iupui.edu Journal of immunology (Baltimore, Md. : 1950) 2009 Only protein-protein interactions imex curation imex curation irf4_consensus_binding_site_il10_promoter ds dna double stranded deoxyribonucleic acid ds DNA ds dna mouse Mus musculus Mouse TGAGGTCTGAAGAAAATCAGCCCTCTCGGG irf4_mouse Interferon regulatory factor 4 Irf4 Spip Lymphocyte-specific interferon regulatory factor NF-EM5 PU.1 interaction partner Transcriptional activator PIP protein protein mouse Mus musculus Mouse MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE ig_light_chain_lambda_(iglc2)_enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse AAAAGGAAGTGAAACCA spi1_mouse Transcription factor PU.1 Spi1 Sfpi1 Sfpi-1 31 kDa-transforming protein SFFV proviral integration 1 protein protein protein mouse Mus musculus Mouse MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHNNEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCFPYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH gata3_mouse Trans-acting T-cell-specific transcription factor GATA-3 Gata3 Gata-3 GATA-binding factor 3 protein protein mouse Mus musculus Mouse MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMEAQYPLTEEVDVLFNIDGQGNHVPSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLAAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVQLPDSMKLETSHSRGSMTTLGGASSSAHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDALEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSGLSFGPHHPSSMVTAMG il10_mouse_gene Interleukin-10 gene gene gene mouse Mus musculus Mouse il4_mouse_gene Interleukin-4 Il4 Il-4 gene gene mouse Mus musculus Mouse irf4_consensus_binding_site_il10_promoter-irf4-2 1876534 N/A 1876537 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1876538 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 physical association physical association false false false 4B irf4_consensus_binding_site_il10_promoter-irf4-1 1876534 N/A 1876537 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1876538 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 N/A 1876539 competitor competitor competitor prey prey in vitro In vitro physical association physical association false false false 4Bi irf4_consensus_binding_site_il10_promoter-iglc2_enhancer-1 1876534 N/A 1876537 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1876538 unspecified role unspecified role prey prey mouse-t-cell_th2 mouse helper T-lymphocyte Th2 Mouse t-cell_th2 T-helper cell 2 N/A 1876537 competitor competitor competitor prey prey G9A,A10T,A11C,G12A,A13G,A14C,A15C,A16C,T_C_A_G_C_C_C_17-23del_del_del_del_del_del_del_ mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 4Bii spi1-gata3-1 1876535 N/A 1876540 unspecified role unspecified role bait bait N/A 1876541 unspecified role unspecified role prey prey N/A 1876538 unspecified role unspecified role prey prey association association false false false 5A spi1-gata3-2 1876535 N/A 1876540 unspecified role unspecified role prey prey N/A 1876541 unspecified role unspecified role bait bait N/A 1876538 unspecified role unspecified role prey prey association association false false false 5Ai Not much IRF4 was precipitated with this complex. gata3-irf4-1 1876535 N/A 1876540 unspecified role unspecified role prey prey N/A 1876541 unspecified role unspecified role prey prey N/A 1876538 unspecified role unspecified role bait bait association association false false false 5Aii irf4-il10_mouse_gene-1 1876536 N/A 1876542 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cn3_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876538 unspecified role unspecified role bait bait association association false false false 4C, 5C P17433 decreases the binding of Q64287 to ENSMUSG00000016529 Q64287 increases at protein level the expression of ENSMUSG00000016529 irf4-il4-2 1876536 N/A 1876543 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Va_site_3_prime_enhancer_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1876538 unspecified role unspecified role bait bait association association false false false 4C, 5C P17433 decreases the binding of Q64287 to ENSMUSG00000000869