IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ahlmann-2009-1 The cyclic AMP response element modulator {alpha} suppresses CD86 expression and APC function. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Ahlmann M., Varga G., Sturm K., Lippe R., Benedyk K., Viemann D., Scholzen T., Ehrchen J., Müller F.U., Seidl M., Matus M., Tsokos G.C., Roth J., Tenbrock K. IBD - Inflammatory bowel disease ktenbrock@ukaachen.de J. Immunol. (0022-1767) 2009 Only protein-protein interactions imex curation cd86_human_gene T-lymphocyte activation antigen CD86 (CD86) human gene gene gene human Homo sapiens Human crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG crem-cd86-2 1767891 n/a 1767892 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767893 unspecified role unspecified role bait bait association association false false false Fig. 3c, 3d antisense CREM construct CD86 promoter DNA also co-precipitated with anti-CREB antibody and this interaction was disrupted by the same mutation in the CD86 promoter that disrupted binding of CREM; however, the exact identity of the targeted CREB protein could not be established, hence this interaction was not captured here. Co-precipitated DNA was identified by PCR using primers specific for the transfected CD86 luciferase construct. crem-cd86-1 1767891 n/a 1767893 unspecified role unspecified role bait bait n/a 1767892 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4a lipopolysaccharide (LPS) (CHEBI:16412) Q03060 decreases expression at RNA level of ENSG00000114013 Q03060 decreases expression at protein level of ENSG00000114013 CHEBI:16412 decreases binding of Q03060 to ENSG00000114013 hist1h4a-cd86-1 1767891 n/a 1767892 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767894 unspecified role unspecified role bait bait possible acetyllys naclys N-acetylated L-lysine NAcLys undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4a lipopolysaccharide (LPS) (CHEBI:16412) CHEBI:16412 increases binding of P62805 to ENSG00000114013