IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tenbrock-2006-2 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease In the presence of recombinant GST-tagged mouse CREM, recombinant GST-tagged mouse HDAC1 also co-precipitated with biotinylated dsDNA containing a consensus CRE site (TGACGTCA), which was precipitated using streptavidin-coated magnetic beads; however, the complete sequence of the DNA probe could not be established, hence this interaction is not captured here. The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation tenbrock-2006-4 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. human-t-cell Homo sapiens t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation tenbrock-2006-5 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation tenbrock-2006-1 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation tenbrock-2006-3 The transcriptional repressor cAMP response element modulator alpha interacts with histone deacetylase 1 to repress promoter activity. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Tenbrock K., Juang Y.T., Leukert N., Roth J., Tsokos G.C. IBD - Inflammatory bowel disease The promoter constructs of the human IL-2 and c-Fos genes are described in PMID:1740667 and PMID:12137955, respectively. The mouse HDAC1 expression construct is described in PMID:10409740. The origin of the mouse CREM expression construct (sense and antisense) was derived from PMID:1847666. ktenbroc@uni-muenster.de J. Immunol. (0022-1767) 2006 Only protein-protein interactions imex curation crem_mouse cAMP-responsive element modulator Crem Inducible cAMP early repressor protein protein mouse Mus musculus Mouse MSKCGRKKYMRTNVRQMTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVSVAGSGTGRGSPAVTLVQLPSGQTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA crem_human cAMP-responsive element modulator CREM Inducible cAMP early repressor protein protein human Homo sapiens Human MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVSVAGSGTRRGSPAVTLVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY fos_human_gene Human FOS gene gene gene human Homo sapiens Human il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS crem-hdac1-1 1767054 n/a 1767059 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli n/a 1767060 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false Fig. 2c hdac1-crem 1767054 n/a 1767061 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli n/a 1767062 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia physical association physical association false false false Fig. 2d hdac1-crem-1 1767054 n/a 1767061 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli n/a 1767059 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2e crem-hdac1-2 1767054 n/a 1767059 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false h domain required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1767061 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2f, 3a crem-fos 1767055 n/a 1767063 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767059 unspecified role unspecified role bait bait association association false false false Fig. 4a crem-fos-1 1767055 n/a 1767063 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767062 unspecified role unspecified role bait bait association association false false false Fig. 4a Q03060 decreases expression at protein level of ENSG00000170345 hdac1-fos 1767055 n/a 1767063 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767060 unspecified role unspecified role bait bait association association false false false Fig. 4a, 4b sense mouse CREM (P27699) expression vector antisense mouse CREM (P27699) expression vector Q03060 increases binding of Q13547 to ENSG00000170345 hdac1-il2 1767055 n/a 1767064 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767060 unspecified role unspecified role bait bait association association false false false Fig. 4a, 4c sense mouse CREM (P27699) expression vector antisense mouse CREM (P27699) expression vector Q03060 increases binding of Q13547 to ENSG00000109471 hdac1-il2-1 1767056 n/a 1767064 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1767060 unspecified role unspecified role bait bait association association false false false Fig. 5a crem-il2 1767056 n/a 1767062 unspecified role unspecified role bait bait n/a 1767064 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a rela-il2-2 1767056 n/a 1767065 unspecified role unspecified role bait bait n/a 1767064 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5a crem-hdac1 1767057 n/a 1767062 unspecified role unspecified role bait bait n/a 1767060 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2b hdac1-crem-2 1767058 n/a 1767061 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli n/a 1767059 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false h domain required to bind necessary binding region required to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 3b