IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ carlson-2006-1 human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Carlson CM., Endrizzi BT., Wu J., Ding X., Weinreich MA., Walsh ER., Wani MA., Lingrel JB., Hogquist KA., Jameson SC. IBD - Inflammatory bowel disease james024@umn.edu,hogqu001@umn.edu Nature 2006 Only protein-protein interactions imex curation imex curation s1pr1_human_gene Sphingosine 1-phosphate receptor 1 S1PR1 CHEDG1 EDG1 gene gene human Homo sapiens Human klf2_mouse Krueppel-like factor 2 Klf2 Lklf Lung krueppel-like factor protein protein mouse Mus musculus Mouse MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSMGLDGLGAENPPEPPPQPPPPAFYYPEPGAPPPYSIPAASLGTELLRPDLDPPQGPALHGRFLLAPPGRLVKAEPPEVDGGGYGCAPGLAHGPRGLKLEGAPGATGACMRGPAGRPPPPPDTPPLSPDGPLRIPASGPRNPFPPPFGPGPSFGGPGPALHYGPPAPGAFGLFEDAAAAAAALGLAPPATRGLLTPPSSPLELLEAKPKRGRRSWPRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM klf2-s1pr1-1 1857959 N/A 1857960 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1857961 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 4A Q60843 increases expression at RNA level of ENSG00000170989