IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ novac-2006-2 Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The experiment was also performed with other oligonucleotides containing predicted nGRE sites, and weak binding of GR was detected to nGRE's located at -530, -470 and -230; however, the sequences of these oligos were not available, hence these interactions are not captured here. GR expression constructs are described in PMID:8076604. t.heinzel@uni-jena.de FASEB J. (0892-6638) 2006 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease novac-2006-1 Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter. human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Novac N., Baus D., Dostert A., Heinzel T. Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease t.heinzel@uni-jena.de FASEB J. (0892-6638) 2006 Only protein-protein interactions imex curation IBD - Inflammatory bowel disease p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 2x-nfkb-re_dna-probe Tandem of NFkB response element from IkBa promoter DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) TGGGGACTTTCCGCTGGGGACTTTCCGC tnfl6_human_ngre/-990_dna-probe Human TNFL6 gene promoter negative GRE/-990 DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AACATAGCAAGTCCCCATCTGTACAAAAAAAAA gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK atty_rat_gre_dna-probe Rat ATTY gene promoter glucocorticoid response element DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid rat Rattus norvegicus (Rat) Rat AATCTCTGCTGTACAGGATGTTCTAGCTACT tnfl6_human_gene Tumor necrosis factor ligand superfamily member 6 (FASLG) human gene gene gene human Homo sapiens Human 2x_nfkb_re-nfkb1 1771740 n/a 1771742 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference n/a 1771743 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5b tnfl6-nfkb1 1771740 n/a 1771742 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference n/a 1771744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5b tnfl6-nfkb1-1 1771740 n/a 1771745 competitor competitor competitor prey prey ecolx Escherichia coli n/a 1771744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1771742 unspecified role unspecified role prey prey human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference association association false false false Fig. 5b tnfl6-nr3c1 1771740 n/a 1771745 unspecified role unspecified role prey prey ecolx Escherichia coli n/a 1771744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false g21t_a25g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 5b tnfl6-nr3c1-1 1771740 n/a 1771745 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 1771744 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false g21t_a25g mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4a, 4b atty-nr3c1 1771740 n/a 1771745 unspecified role unspecified role prey prey human-jurkat Homo sapiens jurkat Human T cell leukemia n/a 1771746 unspecified role unspecified role bait bait region biotin tag biotin tag mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c14g_g20c mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Fig. 4b nr3c1-tnfl6 1771741 n/a 1771745 unspecified role unspecified role bait bait n/a 1771747 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5c dexamethasone (Dex) (CHEBI:41879) (10E-7 M for 30 minutes) P04150 decreases expression at RNA level of ENSG00000117560 CHEBI:41879 indirectly decreases expression at RNA level of ENSG00000117560 CHEBI:41879 increases binding of P04150 to ENSG00000117560 nfkb1-tnfl6 1771741 n/a 1771747 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1771742 unspecified role unspecified role bait bait association association false false false Fig. 5c dexamethasone (Dex) (CHEBI:41879) (10E-7 M for 30 minutes) P04150 decreases binding of P19838-PRO_0000030311 to ENSG00000117560 CHEBI:41879 decreases binding of P19838-PRO_0000030311 to ENSG00000117560