IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ barnich-2005-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Barnich N., Hisamatsu T., Aguirre JE., Xavier R., Reinecker HC., Podolsky DK. IBD - Inflammatory bowel disease dpodolsky@partners.org The Journal of biological chemistry 2005 imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Only protein-protein interactions imex curation barnich-2005-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Barnich N., Hisamatsu T., Aguirre JE., Xavier R., Reinecker HC., Podolsky DK. IBD - Inflammatory bowel disease dpodolsky@partners.org Human bone marrow cDNA library The Journal of biological chemistry 2005 imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Only protein-protein interactions imex curation barnich-2005-3 human-ht_29 Homo sapiens HT-29 caucasian women with colon adenocarcinoma ht_29 HT-29 confirmed as human with IEF of AST, LDH established from the primary tumor of a 44-year-old Caucasian woman with colon adenocarcinoma in 1964; described to be heterotransplantable forming well-differentiated grade I tumors anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Barnich N., Hisamatsu T., Aguirre JE., Xavier R., Reinecker HC., Podolsky DK. IBD - Inflammatory bowel disease dpodolsky@partners.org The Journal of biological chemistry 2005 imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Only protein-protein interactions imex curation barnich-2005-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Barnich N., Hisamatsu T., Aguirre JE., Xavier R., Reinecker HC., Podolsky DK. IBD - Inflammatory bowel disease Figure 2 and associated text states that both Caco-2 and COS7 Cells were transfected with GFP-NOD2 (and HisMAX-GRIM-19); GFP-NOD2 localisation would be shown by Tag-Fluorescence. However the Methods section (Confocal Microscopy) states that Caco-2 cells were transfected with FLAG-NOD2 and an anti-flag antibody used for detection. No mention is made in the Methods section of the use of COS7 cells. dpodolsky@partners.org The Journal of biological chemistry 2005 imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Only protein-protein interactions imex curation barnich-2005-5 human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Barnich N., Hisamatsu T., Aguirre JE., Xavier R., Reinecker HC., Podolsky DK. IBD - Inflammatory bowel disease Figure 2 and associated text states that both Caco-2 and COS7 Cells were transfected with GFP-NOD2 (and HisMAX-GRIM-19); GFP-NOD2 localisation would be shown by Tag-Fluorescence. However the Methods section (Confocal Microscopy) states that Caco-2 cells were transfected with FLAG-NOD2 and an anti-flag antibody used for detection. No mention is made in the Methods section of the use of COS7 cells. dpodolsky@partners.org The Journal of biological chemistry 2005 Only protein-protein interactions imex curation imex curation Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease nod2_human Nucleotide-binding oligomerization domain-containing protein 2 IBD1 NOD2 CARD15 Caspase recruitment domain-containing protein 15 Inflammatory bowel disease protein 1 protein protein human Homo sapiens Human MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNARKVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECALHCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL mint homomint Induces NF-kappa-B via RICK (CARDIAK, RIP2) and IKK-gamma. Confers responsiveness to intracellular bacterial lipopolysaccharides (LPS) Defects in NOD2 are the cause of Blau syndrome (BS) [MIM:186580]. BS is a rare autosomal dominant disorder characterized by early-onset granulomatous arthritis, uveitis and skin rash Defects in NOD2 are a cause of susceptibility to Crohn disease (CD) [MIM:266600]. CD is a form of remitting inflammatory bowel disease (IBD). CD may involve any part of the gastrointestinal tract, but most frequently the terminal ileum and colon. Bowel inflammation is transmural and discontinuous. Crohn disease is commonly classified as autoimmune disease Defects in NOD2 are a cause of susceptibility to ulcerative colitis [MIM:191390]. It is a chronic inflammatory bowel disease. In ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers. Ulcerative colitis is commonly classified as autoimmune disease Defects in NOD2 are the cause of early-onset sarcoidosis (EOS) [MIM:609464]. Sarcoidosis is a multiorganic inflammatory disease with unknown etiology, characterized by the histologic features of non-caseating epithelioid granulomas. In childhood, 2 distinct types of sarcoidosis have been described. Usually the disease is detected in older children by chest radiography and the clinical manifestations are characterized by a classical triad of lung, lymph node, and eye involvement, similar to those in adults. In contrast, early-onset sarcoidosis (EOS), which usually appears in those younger than 4 years of age, is quite rare and has a distinct triad of skin, joint, and eye disorders, without apparent pulmonary involvement. Compared with an asymptomatic and sometimes naturally disappearing course of the disease in older children, EOS is progressive and in many cases causes severe complications, such as blindness, joint destruction, and visceral involvement nduad_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 NDUFA13 CGI-39 CDA016 NADH-ubiquinone oxidoreductase B16.6 subunit Complex I-B16.6 Gene associated with retinoic and interferon-induced mortality 19 protein Cell death regulatory protein GRIM-19 GRIM19 protein protein human Homo sapiens Human MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT nod2-ndufa13-2 1852970 N/A 1852975 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852976 unspecified role unspecified role prey prey n_terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1B nod2-ndufa13-3 1852970 N/A 1852975 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852976 unspecified role unspecified role bait bait n_terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1Bi nod2-ndufa13-1 1852971 N/A 1852975 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false N/A 1852976 unspecified role unspecified role prey prey physical association physical association false false false no figure ndufa13-nod2-1 1852972 N/A 1852975 unspecified role unspecified role prey prey N/A 1852976 unspecified role unspecified role bait bait n_terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1C ndufa13-nod2-2 1852973 N/A 1852975 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852976 unspecified role unspecified role neutral component neutral component n_terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 2 ndufa13-nod2-3 1852974 N/A 1852975 unspecified role unspecified role neutral component neutral component flag or gfp tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1852976 unspecified role unspecified role neutral component neutral component n_terminus xpress tag xpress tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false 2