IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kumar-2003-1 SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kumar K.G., Tang W., Ravindranath A.K., Clark W.A., Croze E., Fuchs S.Y. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The immobilized Skp1-Cul1-Roc1-Fbxw11/HOS complex is described in PMID:10230406. sfuks@vet.upenn.edu EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation kumar-2003-2 SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kumar K.G., Tang W., Ravindranath A.K., Clark W.A., Croze E., Fuchs S.Y. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The immobilized Skp1-Cul1-Roc1-Fbxw11/HOS complex is described in PMID:10230406. sfuks@vet.upenn.edu EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation kumar-2003-3 SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kumar K.G., Tang W., Ravindranath A.K., Clark W.A., Croze E., Fuchs S.Y. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease The immobilized Skp1-Cul1-Roc1-Fbxw11/HOS complex is described in PMID:10230406. sfuks@vet.upenn.edu EMBO J. (0261-4189) 2003 Only protein-protein interactions imex curation inar1_human Interferon alpha/beta receptor 1 IFNAR1 IFNAR Type I interferon receptor 1 Cytokine receptor family 2 member 1 Cytokine receptor class-II member 1 protein protein human Homo sapiens Human MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV fbw1b_human F-box/WD repeat-containing protein 11 KIAA0696 FBXW11 BTRCP2 FBW1B FBXW1B F-box/WD repeat-containing protein 1B F-box and WD repeats protein beta-TrCP2 Homologous to Slimb protein protein protein human Homo sapiens Human MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR inar1_mouse Interferon alpha/beta receptor 1 Ifnar1 Ifar Ifnar Type I interferon receptor 1 protein protein mouse Mus musculus Mouse MLAVVGAAALVLVAGAPWVLPSAAGGENLKPPENIDVYIIDDNYTLKWSSHGESMGSVTFSAEYRTKDEAKWLKVPECQHTTTTKCEFSLLDTNVYIKTQFRVRAEEGNSTSSWNEVDPFIPFYTAHMSPPEVRLEAEDKAILVHISPPGQDGNMWALEKPSFSYTIRIWQKSSSDKKTINSTYYVEKIPELLPETTYCLEVKAIHPSLKKHSNYSTVQCISTTVANKMPVPGNLQVDAQGKSYVLKWDYIASADVLFRAQWLPGYSKSSSGSRSDKWKPIPTCANVQTTHCVFSQDTVYTGTFFLHVQASEGNHTSFWSEEKFIDSQKHILPPPPVITVTAMSDTLLVYVNCQDSTCDGLNYEIIFWENTSNTKISMEKDGPEFTLKNLQPLTVYCVQARVLFRALLNKTSNFSEKLCEKTRPGSFSTIWIITGLGVVFFSVMVLYALRSVWKYLCHVCFPPLKPPRSIDEFFSEPPSKNLVLLTAEEHTERCFIIENTDTVAVEVKHAPEEDLRKYSSQTSQDSGNYSNEEEESVGTESGQAVLSKAPCGGPCSVPSPPGTLEDGTCFLGNEKYLQSPALRTEPALLC ifnar1-fbxw11 1454069 n/a 1454072 unspecified role unspecified role bait bait deg_scf_trcp1_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false required phosphoser-535_phosphoser-539 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false phosphorylation of ser535 and ser539 chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1454073 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig. 1b, Fig. 2e Q9UKB1 is required for ubiquitylation of P17181 Q9UKB1 increases degradation at protein level of P17181 Pre-incubation of unphosphorylated Ifnar1 peptide (C-pep) with extracts from 293t cells stimulates binding to Fbxw11/HOS, even more so when extracts were from cells treated with interferon alpha. ifnar1-fbxw11-2 1454069 n/a 1454073 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1454072 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P17181:p.Ser535Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig. 1d, Fig. 2a This interaction was disrupted by pre-treatment of immuno-purified Ifnar1 with phosphatase lambda for 1 hour at 37C. ifnar1-fbxw11-3 1454069 n/a 1454073 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1454074 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P33896:p.Ser526Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig. 1e cul1-fbxw11-1 1454069 n/a 1454072 unspecified role unspecified role prey prey cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17181:p.Ser535Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1454073 unspecified role unspecified role bait bait c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig. 2d Interferon alpha GST-Ifnar1 was first phosphorylated in vitro in the presence of 32P-radiolabelled ATP by extracts from 293t cells that were untreated or pre-treated with interferon alpha. ifnar1-fbxw11-5 1454069 n/a 1454073 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1454072 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false Fig. 2c This interaction was disrupted by pre-treatment of immuno-purified Ifnar1 with phosphatase lambda for 1 hour at 37C. Interferon alpha fbxw11-ifnar1 1454070 n/a 1454073 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1454072 unspecified role unspecified role prey prey c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P17181:p.Ser535Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1c ifnar1-fbxw11-1 1454070 n/a 1454072 unspecified role unspecified role bait bait P17181:p.Ser535Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1454073 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 1c fbxw11-ifnar1-1 1454071 n/a 1454072 unspecified role unspecified role prey prey n/a 1454073 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2b Interferon alpha ifnar1-fbxw11-4 1454071 n/a 1454073 unspecified role unspecified role prey prey n/a 1454072 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2b Interferon alpha