IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ varshney-2011-4 human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins sunillal@icgeb.res.in PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus varshney-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins sunillal@icgeb.res.in human lung cDNA library PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus varshney-2011-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins Positive (control) interaction between Zeo-Fos and Trp2-Jun was not captured as the origin of species was not known sunillal@icgeb.res.in PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus varshney-2011-3 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins sunillal@icgeb.res.in PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus varshney-2011-5 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins sunillal@icgeb.res.in PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus varshney-2011-6 human-jurkat Homo sapiens jurkat Human T cell leukemia ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Varshney B., Agnihothram S., Tan YJ., Baric R., Lal SK. Virus - Publications including interactions involving viral proteins sunillal@icgeb.res.in PloS one 2011 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus q01196-1 Runt-related transcription factor 1 RUNX1 AML1 CBFA2 Acute myeloid leukemia 1 protein Core-binding factor subunit alpha-2 Oncogene AML-1 Polyomavirus enhancer-binding protein 2 alpha B subunit SL3-3 enhancer factor 1 alpha B subunit SL3/AKV core-binding factor alpha B subunit protein protein human Homo sapiens Human MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY ns3b_sars ORF3b protein Accessory protein 3b Protein X2 3b Non-structural protein 3b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQVR il2_human_gene Human IL-2 gene IL2 gene gene human Homo sapiens Human ns3b_cvhsa-runx1-4 3717937 N/A 3717943 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3717944 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1d panel 1 runx1-ns3b_cvhsa-1 3717937 N/A 3717943 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3717944 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1d panel 2 ns3b_cvhsa-runx1-1 3717938 N/A 3717944 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3717943 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1A ns3b_cvhsa-runx1-2 3717939 N/A 3717943 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3717944 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1b ns3b_cvhsa-runx1-3 3717940 N/A 3717944 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3717943 unspecified role unspecified role bait bait cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 1c ns3b_cvhsa-runx1-5 3717941 N/A 3717943 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-teminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3717944 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 2 il2_human_gene-runx1-1 3717942 N/A 3717945 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Forward primer: 5-'CTCTAGCTGACATGTAAGAAGC-3' Reverse primer: 5'-CTACACTGAACATGTGAATAGC-3' GRCh38:4:122451110-122451132 in reverse strand (forward primer) N/A 3717943 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3-1 SRAS-CoV 3b protein (UniProt:P59633)