DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ unknown-2020-10 ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Zhai Y., Sun F., Li X., Pang H., Xu X., Bartlam M., Rao Z. Coronavirus - Interactions investigated in the context of Coronavirus raozh@xtal.tsinghua.edu.cn Nature structural & molecular biology 2005 Only protein-protein interactions imex curation imex curation unknown-2020-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Zhai Y., Sun F., Li X., Pang H., Xu X., Bartlam M., Rao Z. Coronavirus - Interactions investigated in the context of Coronavirus raozh@xtal.tsinghua.edu.cn Nature structural & molecular biology 2005 Only protein-protein interactions imex curation imex curation unknown-2020-8 in vitro In vitro tem transmission electron microscopy tem experimental particp experimental participant identification experimental particp Zhai Y., Sun F., Li X., Pang H., Xu X., Bartlam M., Rao Z. Coronavirus - Interactions investigated in the context of Coronavirus raozh@xtal.tsinghua.edu.cn Nature structural & molecular biology 2005 Only protein-protein interactions imex curation imex curation unknown-2020-9 in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Zhai Y., Sun F., Li X., Pang H., Xu X., Bartlam M., Rao Z. Coronavirus - Interactions investigated in the context of Coronavirus raozh@xtal.tsinghua.edu.cn Nature structural & molecular biology 2005 Only protein-protein interactions imex curation imex curation p0c6x7-pro_0000037314 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQ 3837 3919 p0c6x7-pro_0000037315 Non-structural protein 8 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQ 3920 4117 rep-79 3711188 N/A 3711192 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3711192 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rep-80 3711188 N/A 3711193 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3711193 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false rep-rep-72 3711189 N/A 3711193 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 N/A 3711192 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 8.0 direct interaction direct interaction false false false Fig1,Table1 rep-rep-73 3711190 N/A 3711193 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3711192 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. S4 rep-rep-74 3711191 N/A 3711193 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3711192 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false