IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ li-2005-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li Q., Wang L., Dong C., Che Y., Jiang L., Liu L., Zhao H., Liao Y., Sheng Y., Dong S., Ma S. Coronavirus - Interactions investigated in the context of Coronavirus Pull down was not curated because of lack antibody specificity. qihanli@public.km.yn.cn human embryo lung Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology 2005 Only protein-protein interactions imex curation imex curation li-2005-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Q., Wang L., Dong C., Che Y., Jiang L., Liu L., Zhao H., Liao Y., Sheng Y., Dong S., Ma S. Coronavirus - Interactions investigated in the context of Coronavirus Pull down was not curated because of lack antibody specificity. qihanli@public.km.yn.cn human embryo lung Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology 2005 Only protein-protein interactions imex curation imex curation btf3_human Transcription factor BTF3 RNA polymerase B transcription factor 3 BTF3 NACB OK/SW-cl.8 Nascent polypeptide-associated complex subunit beta protein protein human Homo sapiens Human MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN p0c6x7-pro_0000037317 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQ 4231 4369 nu4lm_human NADH-ubiquinone oxidoreductase chain 4L MT-ND4L ND4L MTND4L NADH4L NADH dehydrogenase subunit 4L protein protein human Homo sapiens Human MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC cox2_human Cytochrome c oxidase subunit 2 MT-CO2 COII COXII MTCO2 Cytochrome c oxidase polypeptide II COX2 protein protein human Homo sapiens Human MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL atf5_human Cyclic AMP-dependent transcription factor ATF-5 Activating transcription factor 5 Transcription factor ATFx ATF5 ATFX protein protein human Homo sapiens Human MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC rep-btf3-1 3680399 N/A 3680401 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false na Using a GAL-nsp10 fusion protein expressed in yeast as bait, a human embryo lung DNA library was screened using the yeast two-hybrid method (more than 2 × 106 clones). After screening twice using SD/-Leu/-Trp/-His/+25 mm 3-amino-1,2,4-triazole (3-AT) plates, five clones were identified as corresponding to nsp10. Among them, one gene of unknown function warranted further investigation. The other proteins encoded by the other four genes were NADH 4L subunit, cytochrome oxidase II, RNA polymerase B transcription factor 3 and activation transcription factor 5, through comparison with gene sequences in GenBank. rep-atf5-2 3680399 N/A 3680403 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false na Using a GAL-nsp10 fusion protein expressed in yeast as bait, a human embryo lung DNA library was screened using the yeast two-hybrid method (more than 2 × 106 clones). After screening twice using SD/-Leu/-Trp/-His/+25 mm 3-amino-1,2,4-triazole (3-AT) plates, five clones were identified as corresponding to nsp10. Among them, one gene of unknown function warranted further investigation. The other proteins encoded by the other four genes were NADH 4L subunit, cytochrome oxidase II, RNA polymerase B transcription factor 3 and activation transcription factor 5, through comparison with gene sequences in GenBank. rep-atf5-3 3680399 N/A 3680404 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false na Using a GAL-nsp10 fusion protein expressed in yeast as bait, a human embryo lung DNA library was screened using the yeast two-hybrid method (more than 2 × 106 clones). After screening twice using SD/-Leu/-Trp/-His/+25 mm 3-amino-1,2,4-triazole (3-AT) plates, five clones were identified as corresponding to nsp10. Among them, one gene of unknown function warranted further investigation. The other proteins encoded by the other four genes were NADH 4L subunit, cytochrome oxidase II, RNA polymerase B transcription factor 3 and activation transcription factor 5, through comparison with gene sequences in GenBank. rep-atf5-4 3680399 N/A 3680405 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false na rep-atf5-1 3680400 N/A 3680405 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1 rep-btf3-2 3680400 N/A 3680401 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1 rep-mt_nd4l-1 3680400 N/A 3680403 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1 rep-mt_co2-1 3680400 N/A 3680404 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3680402 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1